KEGG   Halobacterium sp. DL1: HALDL1_02675Help
Entry
HALDL1_02675      CDS       T03878                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hdl  Halobacterium sp. DL1
Pathway
hdl00010  Glycolysis / Gluconeogenesis
hdl00053  Ascorbate and aldarate metabolism
hdl00071  Fatty acid degradation
hdl00280  Valine, leucine and isoleucine degradation
hdl00310  Lysine degradation
hdl00330  Arginine and proline metabolism
hdl00340  Histidine metabolism
hdl00380  Tryptophan metabolism
hdl00410  beta-Alanine metabolism
hdl00620  Pyruvate metabolism
hdl00625  Chloroalkane and chloroalkene degradation
hdl01100  Metabolic pathways
hdl01110  Biosynthesis of secondary metabolites
hdl01120  Microbial metabolism in diverse environments
hdl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HALDL1_02675
   00053 Ascorbate and aldarate metabolism
    HALDL1_02675
   00620 Pyruvate metabolism
    HALDL1_02675
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HALDL1_02675
   00561 Glycerolipid metabolism
    HALDL1_02675
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HALDL1_02675
   00310 Lysine degradation
    HALDL1_02675
   00330 Arginine and proline metabolism
    HALDL1_02675
   00340 Histidine metabolism
    HALDL1_02675
   00380 Tryptophan metabolism
    HALDL1_02675
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HALDL1_02675
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HALDL1_02675
Enzymes [BR:hdl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HALDL1_02675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF4156
Motif
Other DBs
NCBI-ProteinID: AHG02648
UniProt: W0K0C1
LinkDB All DBs
Position
222269..223738
Genome map
AA seq 489 aa AA seqDB search
MSDLDLTDVDWTAQYIDGEYVAPDDGDTISVEDPSTREQFAEVPAGTTGDVDAAYEAAAA
AQDEWASRPPQQRASVVRTARDLLKENRDEILDLLAAESGSTRTKGMAEFYTSVGITGEA
ASFPTRMSGDRRDSTVAGKENIVVREPKGVVGVISPWNFPLNLSIRAVAPAIATGNSVVL
KPATNTPVTGGLLLAKLFEAAGLPEGVLNVVTGHGSEVGDRIAGHPEADVVAFTGSTEVG
KQVAGTAATNLATPAMELGGNNVHIVTEDADLDRAIDGGVFGSFLHSGQVCISVNRHLVH
EDVYDEYVHRLTERAEELPTGTAHEPQTVVGPIIDESQRDQILDFVEQTVDAGATVETGG
GHDGLVVEPTVLSDATNDMAAACNEHFGPVAPVIPFSDDDEAVEMANSTDYGLSGSVHSG
DVGRARDIADRIDTGMIHINDQPINDEPHVPFGGVGDSGMGRYNGEAVLEEFTEQKWISV
QREERDYPF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctcgacctcaccgacgtcgactggaccgcacagtacatcgacggcgagtac
gtcgcacccgacgacggcgacaccatctccgtcgaggacccgtcgacgcgcgagcagttc
gccgaggtgcccgcgggcaccactggcgacgtcgacgccgcctacgaggcggccgccgcc
gcgcaggacgagtgggcttcccgcccgccccagcagcgagcctccgtcgtccggaccgca
cgcgacctcctcaaggagaaccgcgacgagattctcgacctcctcgccgccgagtccggg
tcgacgcgcacgaaggggatggcggagttctacacctccgtcggcatcacgggcgaggcc
gcctccttccccacgcggatgtccggcgaccgccgcgactccacggtcgcgggcaaggag
aacatcgtcgtccgcgaaccgaagggcgtcgtcggcgtcatctccccgtggaacttcccg
ctgaacctctccatccgcgccgtcgcccccgccatcgccaccggcaacagcgtcgtcctg
aagcccgcgacgaacacacccgtcacgggcggcctgctgctcgccaaactgttcgaggcc
gccggcctccccgagggcgtgctcaacgtcgtcaccggccacgggtcggaggtcggcgac
cgcatcgccggccaccccgaggccgacgtcgtcgcgttcactggctccactgaggtcggc
aagcaggtcgccggcaccgccgccacgaacctcgcgacgcccgcgatggagctcggcggc
aacaacgtccacatcgtcaccgaggacgcagacctcgaccgcgccatcgacggcggcgtc
ttcggctctttcctccactccgggcaggtctgcatctccgtcaaccgccacctcgtccac
gaggacgtctacgacgagtacgtccaccgactcaccgaacgcgccgaggaactcccgact
gggactgcccacgaaccccagaccgtggtcggccccatcatcgacgagtcccagcgcgac
cagatcctcgacttcgtcgagcagacggtcgacgcaggcgccaccgtcgaaaccggcggc
ggccacgacggcctcgtcgtcgaacccacggtcctctcggacgccaccaacgacatggcc
gccgcgtgcaacgagcacttcggcccggtcgctccggtcatcccgttctcggacgacgac
gaggccgtcgagatggccaactcgactgactacggcctctccggctccgtccactcgggc
gacgtcgggcgcgcccgcgacatcgccgaccgcatcgacaccgggatgattcacatcaac
gaccagcccatcaacgacgaaccccacgtccccttcggcggcgtcggcgactccggcatg
ggccgctacaacggcgaagcggttctcgaagagttcaccgagcagaagtggatcagcgtg
cagcgcgaggagcgggactacccgttctga

DBGET integrated database retrieval system