KEGG   Halobacterium sp. DL1: HALDL1_04870Help
Entry
HALDL1_04870      CDS       T03878                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K19588  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
hdl  Halobacterium sp. DL1
Pathway
hdl00040  Pentose and glucuronate interconversions
hdl00053  Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:hdl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HALDL1_04870
   00053 Ascorbate and aldarate metabolism
    HALDL1_04870
Enzymes [BR:hdl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     HALDL1_04870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHG03000
UniProt: W0K0H7
LinkDB All DBs
Position
671394..672845
Genome map
AA seq 483 aa AA seqDB search
MSSQHRNFIDGDWVESNSGETFENRNPADTKEVIGEYQQSTAEDAEAAIEAANEAADEWA
AMPGPERGRILRKAGEILADRKEELTQTLSHEVGKTTSEAGGEVQRSIDIYAYYAAKASD
FGGTVKESSSPTTHLYSQSEPVGVAGLITPWNFPIAIASWKMAPALAAGNTVVLKPASLA
PGIIRELVEALEDAGIPDGVVNFVTGPGRSVGATVSSSPDVDAVSFTGSHSVGEKVRKQA
VDDGKRVQLEMGGKNPTVVMPSADVDEAVDIVAGGCFGVTGEACTATSKAIVHEDVYEEF
VEKMVDHVESIEVGPGLEDYDMGPHISESELDSTLDYVEIGQQEGATLETGGNRVTGDGY
DDGYFVEPAVFSDVTNDMRIAQEEIFGPVLAIIPVSGFEDALKQANDVRYGLAAGLVTQD
LTEAHEFANRAEAGIVKINEKTTGLELHVPFGGFKDSSSETYREQGDAGLDFYSISRTVY
MNY
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccagcaccgcaatttcatcgacggggattgggtagaatccaactccggcgag
acgttcgagaacaggaacccggcggacaccaaggaagtcatcggcgaataccagcagtcg
acagccgaggacgcggaggcggccatcgaagccgcgaacgaagccgcagacgagtgggcg
gcgatgcccgggccggagcgcggccgcatcctccggaaggcgggcgagatcctcgcagac
cgaaaggaggaactcacgcagacgctctcccacgaggtcgggaaaaccacgtcggaggcg
ggaggtgaggtccagcgctcgatcgacatctacgcgtactatgcagccaaggcgagtgac
ttcggggggaccgtcaaggagtcctcgagcccgactacccacctctactcccagagcgag
ccggtgggcgtcgccggcctcatcacgccgtggaacttcccgatcgccatcgcgtcgtgg
aagatggcgccggcgctcgcggcggggaacaccgtcgtcctcaaacccgcgtcgctcgca
ccgggaatcatccgcgagctcgtggaggcactggaggacgcgggaatccctgacggagtc
gtgaacttcgtcaccgggcccgggaggagtgtcggggccaccgtctcctccagtccggac
gtggacgcggtctcgttcacgggtagccactcggtcggtgagaaggtccgcaagcaggcg
gtcgacgacgggaagcgtgtgcaactggagatgggcgggaagaatccgaccgtcgtgatg
cctagcgccgacgtggacgaagccgtggacatcgtcgcgggcggctgcttcggcgtcacc
ggcgaggcgtgtacggcgacctccaaggcgatcgtccacgaggacgtctacgaggagttc
gtcgagaagatggtcgaccacgtcgagagcatcgaggtcggtccggggctcgaggactac
gacatgggtccgcacatcagcgagtcggagctcgactcgaccctcgactacgtcgagatc
ggccaacaagagggcgcgacgctcgagaccggcgggaaccgcgtcacaggcgacggttac
gacgacgggtacttcgtcgaaccggccgtcttctccgacgtcacgaacgatatgcgcatc
gcgcaggaggagatcttcgggccggtgctcgccatcatcccggtgtcgggcttcgaggac
gcgctgaagcaggccaacgacgtccggtacggactcgcggcggggctcgtcacccaggac
ctcacggaggcccacgagttcgcgaaccgcgccgaagccggcatcgtgaagatcaacgag
aagacgaccgggctggaactccacgtcccgttcggggggttcaaggactcctcgagcgag
acctaccgggagcagggcgacgcgggcctggacttctactcgatcagccgcacggtctac
atgaactactga

DBGET integrated database retrieval system