KEGG   Halobacterium sp. DL1: HALDL1_10425Help
Entry
HALDL1_10425      CDS       T03878                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hdl  Halobacterium sp. DL1
Brite
Enzymes [BR:hdl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HALDL1_10425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: AHG03970
UniProt: W0K3A4
LinkDB All DBs
Position
complement(1684145..1684747)
Genome map
AA seq 200 aa AA seqDB search
MSQHELPPLPYDYDALEPHISEQVLTWHHDTHHQGYVNGLNAAEGTLAENRESGEYGSTA
GALGSVTHNGSGHYLHTMFWENMSENGGGEPSGELADRIEEDFGSYEGWKGEFKAAASAA
GGWALLVYDPVSKQLRNLAVDKHDQGALWGSHPILALDVWEHSYYYDYGPKRGDFIDAFF
EVVDWDDVAENYQKTVSNHE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcacgaacttccgccgcttccatacgactacgacgcgctcgaacctcacatc
agcgaacaggtgctcacgtggcatcacgacacccaccaccaggggtacgtcaacggcctg
aacgccgccgaggggacgctcgcggagaaccgcgagtccggagagtacggctccacggcc
ggcgcgctgggcagcgtcacccacaacggcagtggccactacctccacacgatgttctgg
gagaacatgagcgagaacggcggcggcgagccgtccggtgaactcgccgaccgtatcgag
gaggacttcggctcttacgagggctggaagggcgagttcaaggccgcggcctcggccgct
ggtggctgggcgctcctcgtctacgacccggtgtccaagcagctgcgcaacctggccgta
gacaagcacgaccagggcgcgctctggggttcgcacccgattctggcgctggacgtctgg
gagcactcctactactacgactacggcccgaagcgcggcgacttcatcgacgccttcttc
gaggtcgtcgactgggacgacgtcgccgagaactaccagaagacggtctcgaaccacgag
tag

DBGET integrated database retrieval system