KEGG   Halobacterium sp. DL1: HALDL1_10960Help
Entry
HALDL1_10960      CDS       T03878                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hdl  Halobacterium sp. DL1
Pathway
hdl00564  Glycerophospholipid metabolism
hdl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HALDL1_10960
Enzymes [BR:hdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HALDL1_10960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_binding_3 Pyr_redox_2 Pyr_redox HI0933_like NAD_binding_8 Pyr_redox_3 NAD_binding_7 Thi4 GIDA FAD_oxidored 3HCDH_N NAD_binding_9 ApbA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AHG04061
UniProt: W0JZF3
LinkDB All DBs
Position
1777528..1778745
Genome map
AA seq 405 aa AA seqDB search
MTHETDVLVVGGGATGVGVARDLAMRGVEVTLVERGSLGSGTSGRSHGLLHSGARYADTD
PEGAAECIAESRILRDIAGACVDATGGFFVQLPGDDPDYFERKVAACRDVGIPVDVRDGE
AARADEPGLSADTERVAEVPDGVVYPSRLVAATAADARGHGASVHTHTPVRSLLVEDGRV
VGADVRGVGRIDADHVVNATGAWADSLAATAGVELDLHPTKGAMVVVEYADLDTVLNRCR
PAADGDIVVPHADRVVLGTTSVEVADPDDVPEDEAEVERVLAECRALLPELDDHEVERAY
WGVRPLYSPRSYGEDARAISRGFYLLNHADRDGVPGLTTIVGGKLTTYRLMAEATADHVA
DRLGVAEPCRTAAEPLVGHDDPAELDALVDEFDAANPADADVRDD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgactcacgagactgacgtcctcgtcgtgggcgggggagcgaccggcgtcggggtcgcc
cgcgacctcgcgatgcgcggcgtggaggtgaccctcgtcgagcgcggcagcctggggagc
ggtacctccgggcgctcgcacggcctgctccacagcggcgcgcgctacgccgacaccgac
ccagagggcgccgcggagtgcatcgcggagagccgaatcctccgcgacatcgcgggcgct
tgcgtcgacgccacgggtgggttcttcgtccaactccccggcgacgaccccgactacttc
gagcggaaggtcgctgcttgccgcgacgtcggcatccccgtcgacgtgcgcgacggcgag
gcggcccgcgcggacgaaccaggactctcggcggacaccgagcgagtggcagaagtcccg
gacggtgtcgtctacccctcgagattggtcgcagcgaccgccgcggacgcccgcggccac
ggcgcgagcgtccacacgcacaccccggtccgcagtctcctcgtcgaagacgggcgcgtg
gtcggtgcagacgtgcgaggcgtcggcagaatcgacgccgaccacgtcgtcaacgcgacg
ggcgcgtgggccgactcgctggccgccacggccggcgtcgaactcgacctccacccgacg
aagggcgcgatggtcgtcgtagagtacgcggacctcgacacggtgttgaaccgctgtcgg
cccgccgccgacggcgacatcgtcgtgccccacgccgaccgcgtcgtcctcggcacgacc
agcgtcgaagtcgcggaccccgacgacgtccccgaggacgaggcggaggtcgagcgcgtc
ctcgcggagtgtcgcgcgctcctgccggaactggacgaccacgaggtcgaacgcgcgtac
tggggcgtccgcccgctgtacagcccgcggtcctacggcgaggacgctcgcgccatctct
cggggcttctacctgctcaaccacgccgaccgggacggcgttccaggcttgaccaccatc
gtcggcgggaaactcacgacctaccggctgatggccgaggccaccgccgaccacgtcgct
gaccgtctcggagtggccgagccgtgccggaccgcagccgaaccgctggtcggccacgac
gacccggcggaactggacgcactcgtcgacgagttcgacgcggcgaaccccgccgacgcc
gacgtccgtgacgactga

DBGET integrated database retrieval system