KEGG   Halobacterium sp. DL1: HALDL1_12920Help
Entry
HALDL1_12920      CDS       T03878                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hdl  Halobacterium sp. DL1
Pathway
hdl00620  Pyruvate metabolism
hdl01100  Metabolic pathways
hdl01120  Microbial metabolism in diverse environments
hdl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HALDL1_12920
Enzymes [BR:hdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     HALDL1_12920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Ubiquitin_2
Motif
Other DBs
NCBI-ProteinID: AHG04399
UniProt: W0K0H8
LinkDB All DBs
Position
2136535..2138781
Genome map
AA seq 748 aa AA seqDB search
MGLDEDALDYHASDPPGKLEIATTKPTNTQRDLSLAYSPGVAAPCLEIADDPENAFKYTA
KGNLVGVVSNGSAVLGLGDIGAQASKPVMEGKGVLFKRFADIDVFDIELDQQDAADIIES
VNAMEPTFGGINLEDIKAPECFEIEDRLREKMDIPVFHDDQHGTAIISGAALLNAVEISG
KDISEVEVVFSGAGASAIASARFYVSLGVQRENITMCDSSGIITEDRDVNEFKEEFAQPG
EGGDLADAMDGSDVFVGLSVGGIVSEEMVQSMTADPIVFAMANPDPEIDYEAAKNARDDT
VIMATGRSDYPNQVNNVLGFPFIFRGALDVRATDINEKMKVACAEALADLAKQDVPDEVV
KAYGDQPLQFGSEYIIPKPLDPRVLFEVAPAVARAAQDSGVARRELDLEDYREKLEARLG
KSREMMRIVLNKAKSDPKRVALGEGDDEKMIRAAYQMAEEGIAEPVLIGDRETIHGIVEG
LGLQFEPEIVDPDEGDHEEYAEQLYELRQRKGITESEAESLVKRDPNYLGSTMVRAGDAD
AFLTGLMHHYPSALRPPLQVVGTAPDADYVAGVYMLTFKNRVVFCADTTVNQDPDEEVLA
EVAQHTADLARRFNVDPRVAMLSYSNFGSVDNEGTRKPRHAARMLREDPDVDFPVDGEMQ
ADTAVVEDILGGTYEFSELDDPANVLIFPNLESGNIGYKLLQRLGGADAIGPMLVGMDKP
VHVLQRGDEVKDIVNLAAVAVVDAQQNE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgggactggacgaagacgcgctggactaccacgccagcgacccgccagggaaactcgag
atcgcgacgacgaagccgacgaacacgcagcgggacctctcgctggcgtactcgcccggc
gtggccgcgccgtgcctggaaatcgccgacgaccccgagaacgcgttcaagtacaccgcg
aaggggaacctcgtcggcgtcgtgtcgaacggctcggcggtgctcggcctcggcgacatc
ggcgcccaggcctccaagccggtcatggaggggaagggagtgctgttcaagcggttcgcg
gacatcgacgtcttcgacatcgaactcgaccagcaggacgccgcggacatcatcgagtcc
gtcaacgcgatggagccgacgttcggcggcatcaacctcgaggacatcaaggcgccggag
tgcttcgagatcgaggaccgcctccgcgagaagatggacatcccggtgttccacgacgac
cagcacggcaccgctatcatctccggggcggcgcttttgaacgccgtggagatctccggg
aaggacatctcggaggtcgaggtcgtcttctcgggcgccggcgcctccgccatcgccagc
gcgcgcttttacgtcagtctcggcgtccagcgggagaacatcacgatgtgtgactcctcg
ggcatcatcaccgaggaccgcgacgtcaacgagttcaaagaggagttcgcccagcccggc
gagggcggcgacctcgcggacgcgatggatggctcggacgtgttcgtcggtctctccgtc
ggtggtatcgtcagcgaggagatggtccagtcgatgaccgcggaccccatcgtgttcgcg
atggcgaacccggaccccgagatcgactacgaggccgcgaagaacgcccgcgacgacacc
gtcatcatggcgaccgggcgctcggactaccccaaccaggtgaacaacgtcctcggcttc
ccgttcatcttccggggcgcactcgacgtgcgcgccaccgacatcaacgagaagatgaag
gtcgcgtgcgcggaggcgctcgccgacctcgcgaagcaggacgtccccgacgaggtcgtg
aaggcctacggcgaccagcccctgcagttcggctccgagtacatcatcccgaaaccgctc
gacccgcgcgtactgttcgaggtggcgcccgccgtcgcgcgcgccgcccaggactcgggc
gtcgctcgccgcgaactcgacctcgaggactaccgcgagaaactcgaggcgcgcctcggg
aagtcccgcgagatgatgcgcatcgtcctcaacaaggccaagagcgacccgaagcgcgtg
gcgctcggcgagggcgacgacgagaagatgatccgcgcggcctaccagatggccgaggag
ggcatcgccgagcccgtgctcatcggcgaccgcgagaccatccacggcatcgtcgagggg
ctgggcctccagttcgagcccgagatcgtcgaccccgacgagggcgaccacgaggagtac
gccgaacagctgtacgaactccgccagcgcaagggcatcacggagagcgaggccgagtcg
ctcgtgaaacgcgaccccaactacctcggttccacgatggtgcgagccggcgacgccgac
gccttcctcacgggcctgatgcaccactacccgagcgcgctccgcccgccgctgcaggtc
gtcggcacggcgccggacgccgactacgtcgcgggcgtctacatgctgacgttcaagaac
cgcgtcgtcttctgcgcggacaccaccgtcaatcaggaccccgacgaggaggtgctcgcg
gaggtcgcccagcacacggcggacctcgcccggcggttcaacgtcgacccgcgcgtcgcg
atgctgtcgtactcgaacttcggcagcgtcgacaacgagggcacccggaagccccggcac
gccgcacggatgctccgcgaggacccggacgtcgacttccccgtcgacggcgagatgcag
gccgacaccgccgtcgtcgaggacatcctcgggggcacctacgagttctcggaactcgac
gaccccgcgaacgtgctcatcttcccgaatctggagtcgggcaacatcggctacaagctg
ctccagcgcctcggcggcgctgacgccatcggcccgatgctggtcggcatggacaagccc
gtccacgtcctccagcggggcgacgaggtgaaggacatcgtgaacctcgccgccgtcgcc
gtcgtcgacgcacagcagaacgaatga

DBGET integrated database retrieval system