KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_0246Help
Entry
Hden_0246         CDS       T01265                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00473  D-Alanine metabolism
hdn00550  Peptidoglycan biosynthesis
hdn01100  Metabolic pathways
hdn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Hden_0246
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hden_0246
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Hden_0246
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hdn01011]
    Hden_0246
Enzymes [BR:hdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Hden_0246
Peptidoglycan biosynthesis and degradation proteins [BR:hdn01011]
 Precursor biosynthesis
  Amino acid ligase
   Hden_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N
Motif
Other DBs
NCBI-ProteinID: ADJ22071
UniProt: D8JQR9
LinkDB All DBs
Position
249041..249994
Genome map
AA seq 317 aa AA seqDB search
MTKLGALPKRTRDHVAVLKGGLSAERDVSLNSGAAVGEALREEGYRVTEIDVDRNLAAQL
EAINPDVCFNALHGKFGEDGCVQGVLEMLAIPYTHSGVLASALAMHKERAKDIMKLAGVA
VAEAKLVTRREAAEAHVLPPPYVVKPPTEGSSVGVVIVPPGADRPPSSIASGGSPDQIVM
VERYVPGRELTCAVIGDFVTDVIEIVPLRGLAFYDYESKYGAGGSKHELPAQLLPDVYQS
VRSLTLRAHQALGCRGVSRADFRFDDTAGGTGELICLEVNTQPGMTGTSLVPELAGHAGW
SFGDLVRWMVEDASCNR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactcggcgcgttgccgaagcgcacgcgcgatcacgtggccgttctcaagggc
gggctttccgccgagcgcgacgtcagtctcaactcgggcgcggctgtcggagaagcgctg
cgcgaggaaggctatcgcgtcaccgagatcgacgtcgatcgaaaccttgcggcgcagctc
gaagcgatcaatccggacgtctgtttcaacgcgctgcacggcaagttcggcgaggacggg
tgcgtccaaggcgtcctcgaaatgctggcgatcccgtacacgcattccggagttctggcc
tcggcgctcgcgatgcacaaggagcgcgccaaggacatcatgaagctcgcgggcgttgcc
gtcgccgaagcgaagctcgtcacacggcgtgaggctgcggaggcccatgtcctgccgccg
ccctacgtggtgaagccgccgaccgagggttcgagcgtcggggtcgtgatcgtcccgccc
ggcgccgatcggcccccgagttcgatcgcatccgggggctctcccgaccagatcgtgatg
gtcgagcgctacgtgccgggacgtgagctaacttgtgctgtgatcggagatttcgtgacc
gacgtcatcgaaatcgtgccgctccgagggctcgctttctacgattatgaatcgaaatac
ggtgcgggcggctcgaagcacgagctgccggcacaacttttaccggatgtttaccagtca
gtccgttccttaacgttaagggcgcatcaggcgctgggctgccgaggcgtgtcgcgggcg
gatttccgtttcgacgatacggctggtggaaccggcgagctgatctgtctcgaagtgaac
acccaaccgggcatgacgggaacgtccctcgtgcctgaattggcgggtcatgcgggctgg
tcgttcggtgacctcgtccgatggatggtcgaggacgcgagttgcaacaggtag

DBGET integrated database retrieval system