KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1880Help
Entry
Hden_1880         CDS       T01265                                 

Definition
(GenBank) ABC transporter related protein
  KO
K19340  Cu-processing system ATP-binding protein
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Hden_1880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hdn02000]
    Hden_1880
Transporters [BR:hdn02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Copper-processing transporter
    Hden_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_24 AAA_15 AAA_16 AAA_23 RsgA_GTPase AAA_33 MMR_HSR1 AAA_22 TsaE
Motif
Other DBs
NCBI-ProteinID: ADJ23683
UniProt: D8JZ81
LinkDB All DBs
Position
complement(1912086..1913009)
Genome map
AA seq 307 aa AA seqDB search
MTAIVELEHIEKRYGAIAAVNDVSFALQPGESVALIGHNGAGKTTLFKMMLGLSRPTSGD
IRVLGDHPAAGEFAARKRLGYLPESVSFNGALTGREVLSFYARLKDASTDKIDSLLERVG
LTAAADRPIRTYSKGMRQRLGLIQALFGDPLLLLLDEPTTGLDPALRLEFYEIVQELQQQ
GATIVLSSHALTELEERASRIIILNRGRMVANGSIDELRKLAGLPIKIRVTVASGKAEKL
SALVGPVPNWREINGHLVEFDAAPGAKIELIRRATDAAGPAQDVAILQPTLDDLYAHFLR
RHGEAAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcgtcgaactcgagcacattgaaaagcgctacggcgcgatcgcggcggtg
aatgatgtctccttcgcgctgcagccgggcgagtcggttgctctgatcggccacaacggc
gccggcaagacgacgcttttcaagatgatgctcgggctttcacgtccgacgtcgggcgac
atccgcgtgctcggtgatcaccccgccgccggagagttcgcggcacgcaagcggctcggc
tatctacccgagagcgtttcattcaacggcgcgctgacgggccgcgaagtgctgtcgttt
tacgcccgcctcaaggacgcatcgactgataaaatcgacagccttctcgagcgcgtcggt
ctcacggccgccgcggaccggccaatccgaacgtattcgaaaggcatgcgccagcggctc
ggcttgatccaggcgctgttcggcgatccgttgctgcttctcctcgacgagccgacgacc
ggcctcgatccggcgctgcggctcgaattctacgagatcgtgcaagagctgcagcagcag
ggcgcaacgatcgtgctctcgtcgcatgcactgaccgagctcgaggaacgcgccagccgc
atcatcattctcaatcgcggacggatggtcgccaacggctcgatcgacgagctgcgaaag
ctcgcagggctgccgatcaaaattcgcgtcaccgtcgcctccggaaaggcggaaaaactt
tcggcgctcgtcggaccggttccgaactggcgcgagatcaacggccatctcgtcgaattc
gacgcggcgccaggcgccaagatcgaactcatccgccgagcgaccgatgcggcaggaccc
gcacaggatgttgcgatcctgcagccgacactcgacgatctctacgcgcacttcctgcgc
cgtcacggcgaggccgcagcatga

DBGET integrated database retrieval system