KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2051Help
Entry
Hden_2051         CDS       T01265                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00061  Fatty acid biosynthesis
hdn00780  Biotin metabolism
hdn01100  Metabolic pathways
hdn01130  Biosynthesis of antibiotics
hdn01212  Fatty acid metabolism
Module
hdn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Hden_2051
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Hden_2051
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Hden_2051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hdn01004]
    Hden_2051
Enzymes [BR:hdn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Hden_2051
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Hden_2051
Lipid biosynthesis proteins [BR:hdn01004]
 Fatty acid synthase
  Component type
   Hden_2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ADJ23852
UniProt: D8JPW8
LinkDB All DBs
Position
complement(2099258..2100031)
Genome map
AA seq 257 aa AA seqDB search
MKPIVDLTGKRVLVVGIANKSSIAYGCAEALKAAGADLAVTYLNAKAEPHVRPLAEELNA
SIIVPCDVRIQGELESVFDTIRATWGRLDGIVHSIAFAPREDLHNSLVLCSAEGFAMAMD
VSCHSFIRMAKLALPLMVDGGSLQTVSFFGASRVVEHYNLMGPVKAALEATVRTLASDLA
PRRIHVHALSSGPIATRAASGIDRFDELLEKTRERTPDHQLVTIEQIGRISAFLASDAGS
AMTGSTSYADHGFHVVA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatcgtcgatctcaccggcaagcgcgttcttgtcgtcggcatcgccaacaag
agcagcatcgcctatggctgtgccgaggcactgaaggccgccggtgccgacctcgcggtg
acgtacctgaacgccaaggccgaaccacatgtgaggccgttggcggaggaactgaacgcg
tcgatcatcgtcccgtgcgatgtccgcattcaaggcgagttggaaagcgttttcgatacc
attcgcgcgacgtggggtcgtctcgacggcatcgtgcattccatcgccttcgcgccacgc
gaggacttgcacaacagtcttgtgctgtgctcggccgaaggcttcgcgatggcaatggat
gtctcatgccactcattcatccgcatggcgaagctggcgttgccgttgatggtcgatggc
ggcagcctgcaaacggtgagtttcttcggcgccagccgcgtggtcgagcactataatctc
atggggccagtcaaggccgcgctggaagcgacggtgcggactctcgcttccgatctcgcg
ccgcgccgcatccatgtgcacgcgctgtcatccgggccgatcgcgacgcgcgcggcctca
gggatagatcgcttcgacgagcttttggaaaagacgcgcgagcgcacgccggatcatcag
ctggtgacgatcgaacagatcgggcgcatctcggcatttctcgcaagcgacgccggaagc
gccatgacgggctcgacgtcctatgccgaccacggcttccacgtcgtcgcgtaa

DBGET integrated database retrieval system