KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2089Help
Entry
Hden_2089         CDS       T01265                                 

Definition
(GenBank) amino acid permease-associated region
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Hden_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C DUF3645
Motif
Other DBs
NCBI-ProteinID: ADJ23888
UniProt: D8JQD4
LinkDB All DBs
Position
complement(2140128..2141609)
Genome map
AA seq 493 aa AA seqDB search
MPNLFRKKAVAYDNSEFGLKRCLSALDLTLLGVGAIIGTGIFVLTGHAAAVQSGPGVVLS
FIVAGVACGFAALSYAELASSVGGCGSAYGYSYAAFGELIAWIIAWDLILEYGVSVAAVA
NGWSGYLNNALTAMGIGLPDTLVRGPSALAWNEHLGGALQWFGFDPNAPGVKEAGRGGFI
NLPAAGVILMLMLLLIAGVKESARINAAAVVIKLIAIAIFIGVAVFNVNPDNWSPFLPFG
WFSHDGSRPIGVLAGASIVFFAYVGFDAVSTAVEEAYDPQRDVPIGILAALVFCTVIYVI
VSALMTGIVPYHALNVPSPASEALLRIGHNTAAGLVATGVVAGLTTVMLVLYYALTRIIV
GVSRDGLLPSFFEAVNPRTQTPVRTTVIAGTVMAIMAGFIPLGVLAELVNIGTLAAFVLV
CGGVIALRFSHPDMPRPFKTPGGIVLPVLGILSCGSLIAFLPYETHLRFIAWLALGLVIY
FGYSIRRSKLAVA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatctcttcagaaaaaaagcggtcgcctacgacaactccgaattcgggttgaag
cgctgcctgagcgcgctggatctcaccctgctcggcgtcggcgcgatcatcggaaccggc
attttcgtgctgaccggccacgccgccgcggtccagtcggggccgggagtcgtgctctcg
tttatcgtcgcgggcgtcgcatgcgggtttgcggcgctttcttatgccgaattggcctcg
agcgtcgggggctgcggcagcgcctacggctacagctatgcggccttcggcgaactgatc
gcctggatcatcgcctgggacctgatcctcgaatatggcgtctcggtcgccgccgtcgcc
aacggctggtcggggtatttgaacaacgccctgacggcaatggggatcggactgccggac
accctggtccggggaccgagcgcgctcgcgtggaacgagcatcttggcggtgctctccaa
tggttcggcttcgatccgaacgcgccgggggtgaaggaggcaggtcgcggcggcttcatc
aatctgcctgctgcgggcgtcattctgatgctgatgcttttgctcatcgcgggtgtcaag
gaaagcgcccgcatcaacgccgcggcggtcgtgatcaaactgattgccatcgcgattttc
atcggcgtcgcggttttcaacgtcaatcccgacaactggtcgccattcctgccgtttggc
tggttcagccacgacggcagccgccccatcggcgtcctggccggtgcgtcgatcgtcttt
ttcgcctacgtcggctttgacgccgtttcgacggcggttgaggaggcctatgacccgcaa
cgcgacgtgccgatcggtatcctcgcggcgctggtcttttgtacggtcatttacgtgatc
gtctctgcgctgatgaccggcatcgtgccgtatcacgcgctgaacgtgccttctccagcg
tcggaggcgctgctgcgcatcgggcacaatacggcagccgggctcgtcgcaacgggcgtc
gtcgccggtctcacgacggttatgctggtgctttattatgccctgactcgcatcatcgtc
ggcgtttcgcgcgacggcctgcttccttcgtttttcgaggccgtcaatccgcggacgcag
acgcctgttcggacgaccgtcatcgcgggtaccgttatggcgatcatggcgggtttcatc
ccgctgggcgttctggccgaactcgtcaacatcggcacgctggcggcttttgtgctcgtc
tgcggcggcgttatcgccctgcgcttttcacaccccgacatgccgcgcccgttcaagacg
ccgggcgggatcgtgctgccggttctgggcattctctcgtgcggatcgctgatcgcgttc
ctgccctatgagacgcatctgcgcttcattgcctggcttgcgctcgggctggtgatctac
ttcggatactcgatccggcgcagcaagctcgcggtggcctga

DBGET integrated database retrieval system