KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_26178Help
Entry
HYPDE_26178       CDS       T02646                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
hdt00010  Glycolysis / Gluconeogenesis
hdt00520  Amino sugar and nucleotide sugar metabolism
hdt01100  Metabolic pathways
hdt01110  Biosynthesis of secondary metabolites
hdt01120  Microbial metabolism in diverse environments
hdt01130  Biosynthesis of antibiotics
hdt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYPDE_26178
   00520 Amino sugar and nucleotide sugar metabolism
    HYPDE_26178
Enzymes [BR:hdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     HYPDE_26178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AGK56918
UniProt: N0B1U5
LinkDB All DBs
Position
complement(741243..742004)
Genome map
AA seq 253 aa AA seqDB search
MSDVSGKEKATGTGPNTLAIDVGGTGLKASVLDEAGRMLVKRVRVATPYPCHPEILLNAI
AELTAPLPPSERISIGFPGVVRSGKILTAPHFDVQTWRDYPLEKALSRRFGKPARLLNDA
DVQGLGIVAGRGLEVVLTLGTGIGSAVFDNGMLAPHLELAHHPIHKDETYNDYIGAEARR
AHGLEKWNRRVLRTIDIVYSLLHYDLLYLGGGNSADVDIDNLPDHVRIASNDAGITGGIR
LWDEKVWQAVRND
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtcagcggcaaggaaaaagcgaccggaaccggcccaaacacgttggcgatc
gatgtcggcggcacggggctcaaggcatcggttctagatgaggctggtcggatgctcgtc
aagagggttcgcgtcgcgacgccttatccgtgccatcctgaaattctgttgaacgcgatc
gccgaactgaccgcaccgcttcctcccagcgagcgcatctccatcggctttccgggagtg
gtccgcagcggcaaaattctgacggcgccgcatttcgatgtccaaacttggcgcgactat
ccattggagaaggccttatcgcgccgcttcggcaagccggcacgtctcctcaacgacgcg
gacgtgcagggcctggggatcgtcgcggggcgtgggctcgaagtcgtcctgacgctcggt
acgggcatcggcagcgcggtgttcgacaacggtatgctggcgccccacctcgaactcgcc
catcatccgatacacaaggacgagacctataacgactacattggcgccgaggcccgtcgc
gcacatggcctcgagaaatggaatcgccgcgtgctccgtacgatcgatatcgtctattcc
ttacttcattacgacctcttgtatctcggtggcggaaactctgccgatgtcgatatcgat
aatttacccgaccacgtccgtattgcttccaacgatgccggcatcacgggcggtatccgc
ctctgggatgaaaaagtctggcaagccgtccgcaacgactga

DBGET integrated database retrieval system