KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_34293Help
Entry
HYPDE_34293       CDS       T02646                                 

Definition
(GenBank) multidrug resistance protein A
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Brite
KEGG Orthology (KO) [BR:hdt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hdt02000]
    HYPDE_34293
Transporters [BR:hdt02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   HYPDE_34293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD ADH_N HlyD_2
Motif
Other DBs
NCBI-ProteinID: AGK58530
UniProt: N0BEK8
LinkDB All DBs
Position
2317176..2318147
Genome map
AA seq 323 aa AA seqDB search
MPRANCDQKPNEARMQDAPPKMLQGQKNSKMQQGQKSLPKANPTSTVHPPAPQSRGLLRS
WPALAGLLATLAIIAAGYAYWHYSVLHPSTDNAYVQANIVPIAPLTSGLVTEVNAKEFAT
VKAGDVLVRLDPAPFEAALKAAEAKLTLAQQQATGPAAQSPAAKANIYQAQAGADQARLE
LDHATIKAPVDGIIGKVRVRPGSIAKAGMSLFPLIDTSKWWVDANFKETDLARIEAGQKA
TITIDLFPSHEFSGEVEAVSPASGAAFSLLPAENSTGNWVKTTQRFPVRVALTLKPGDPE
MRIGASASVTVDTTSKGSGSGAQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
ttgcccagggcgaattgcgatcagaagccgaacgaggcccgcatgcaggatgcacccccc
aagatgctgcaaggacaaaagaattcgaaaatgcagcaaggacagaaatccttacccaaa
gcgaatccgacttctacggtgcaccctcccgcgccgcagagccgaggtctattgaggagt
tggccggcgctcgccgggcttctcgcaactctcgcgatcatcgcggccggctacgcctac
tggcactattcggtgctccatccttcgaccgacaatgcctatgtccaagccaatatagtg
ccaatcgctccgctgacgtcagggctcgtgaccgaggtcaacgccaaggaatttgcaacc
gtcaaagcgggcgatgttctagtgcgactcgatcctgcgccgttcgaagctgcgctcaaa
gcggcggaagcgaagctgacgcttgcacagcagcaggcgaccggcccagcggcgcaatct
cccgcagccaaggccaacatctatcaggcgcaggctggcgccgatcaggcacgcctcgaa
ctcgatcatgcaacgattaaggcccctgtcgatgggatcattggcaaggtgcgcgtccgc
cctgggtcgattgccaaagccggcatgagtctattcccattaatcgatacttcgaaatgg
tgggtcgacgcgaacttcaaggaaacggaccttgcgcgcatcgaagcgggtcagaaagcc
acgataacgatcgacctctttccgtcgcatgagttcagcggcgaagtggaagccgtgagc
cccgccagcggtgccgcgttttcactgctgccggccgaaaactcaacggggaactgggtg
aagacaacgcagcggtttcccgtccgcgtcgcgctcacgttgaagccgggtgatcccgaa
atgcgcatcggcgcatcggcatccgtcaccgtcgataccaccagcaagggttccggcagt
ggcgctcagtga

DBGET integrated database retrieval system