KEGG   Haemophilus ducreyi: HD_0821Help
Entry
HD_0821           CDS       T00135                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hdu  Haemophilus ducreyi
Pathway
hdu00473  D-Alanine metabolism
hdu00550  Peptidoglycan biosynthesis
hdu01100  Metabolic pathways
hdu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hdu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HD_0821 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HD_0821 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HD_0821 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hdu01011]
    HD_0821 (ddlB)
Enzymes [BR:hdu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HD_0821 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:hdu01011]
 Precursor biosynthesis
  Amino acid ligase
   HD_0821 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 RimK ATP-grasp_3 R2K_2 ATPgrasp_Ter CPSase_L_D2 ATPgrasp_ST ATP-grasp GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AAP95719
UniProt: Q7VMY2
LinkDB All DBs
Position
complement(652519..653430)
Genome map
AA seq 303 aa AA seqDB search
MNIKNEKIAVLYGGTSQEREVSLHSGAAVTEALKSLGYNVEGIDTKDIAIEKLKEKGIQR
VFNILHGGIGENGVLQGALEQMGIPYTGCGVMASAITLDKFRTKLLWNAVGLPTADMVVV
QRGQAIDINQIIAKLSLPVFVKPSSEGSSVGVFKVKTKEELLPAITAALEFDTIVLVEEF
LTGAEYSVPVLDGEVLPAVQIIPDGEFYDYHAKYLSDKTQYIVPALTNERQAEVAKIVKA
AYDVVGCRGWSRIDVMEDQNQNFRLVEVNTNPGMTSHSIFPKSAATMGISFEKLVERVLE
LSI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaagaacgaaaaaattgcggtgttatatggcggtacttcacaagaacgtgaa
gtgtctctacactcaggtgcagcagtcacagaagcattaaaaagcctaggttacaatgta
gaaggtattgatacaaaagatatcgctattgagaaattaaaagaaaaaggcattcagcga
gtcttcaacattctacatggcggaataggtgaaaatggtgtattgcaaggtgctttagaa
caaatggggattccatacactggttgtggtgtaatggcttcagctatcacattagataaa
ttccgtaccaaattattatggaatgctgtcggtttacccacagcagatatggtagtagtg
caacgaggacaagcaatcgatattaatcaaattattgcaaaattaagtttacctgttttt
gtcaaaccatcaagtgaaggttcaagtgtcggcgttttcaaagtcaaaacaaaagaagaa
ttactgcccgcgattaccgcagcactggaatttgatactatcgtattagtagaggaattt
ttgaccggtgctgaatattcagtccctgttttagatggcgaagttttacctgcggtgcaa
atcattcctgatggtgaattttacgattatcacgctaaatacctttccgacaaaacccaa
tatattgtgcccgcattaactaatgaacggcaagcagaagtcgccaaaatagtcaaagcc
gcttatgatgttgttggttgtcgtggttggagtcgaattgatgttatggaagatcaaaac
caaaattttcgtttagtagaagtcaacactaatcctggaatgactagccatagcattttt
cctaaatctgctgctacaatgggtatttcatttgaaaaactagttgaacgagtattggag
ttaagcatctaa

DBGET integrated database retrieval system