KEGG   Haemophilus ducreyi: HD_0843Help
Entry
HD_0843           CDS       T00135                                 

Gene name
hslO
Definition
(GenBank) chaperonin heat shock protein 33
  KO
K04083  molecular chaperone Hsp33
Organism
hdu  Haemophilus ducreyi
Brite
KEGG Orthology (KO) [BR:hdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hdu03110]
    HD_0843 (hslO)
Chaperones and folding catalysts [BR:hdu03110]
 Heat shock proteins
  HSP33
   HD_0843 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AAP95735
UniProt: Q7VMW7
LinkDB All DBs
Position
670876..671769
Genome map
AA seq 297 aa AA seqDB search
MQHIQDNDKLYRYLFQHRAVRGEWVRLNETFSQTLNTHQYPKAVQHLLGEMLVATSLLTA
IMKFEGNITVQIQGDGPLKLAVVNGNEKQQLRALARVQAEIDDQASLAEMVGNGVLVISI
IPTEGERYQGVIQLDKPTIRECLEDYFIRSEQLQTHLIIRVGEYAGQAVAAGMLLQIMPD
GTGTPEDFEHLMTLAETVKDEELFGLTAEALLYRLFHQEQVEVYPAQTTAFKCGCSRERS
GQAMLLLPMAEIEEMLAEKKGVIDMQCECCGTQYFFDKPAIMLLKEEAAKLADLGLT
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatatccaagataacgataaattataccgctatttatttcaacatagagcagta
cgaggtgaatgggtcaggctgaatgaaacatttagtcaaacattaaatacccatcaatat
cctaaagcagtacaacatttattgggtgaaatgctggttgcaaccagtttattgaccgct
attatgaaatttgaagggaatattaccgttcaaattcaaggtgatggaccattgaaatta
gcggtagtaaatggcaacgaaaaacaacagttacgtgctttagcccgtgttcaagcagag
attgatgaccaagctagcttagctgaaatggtagggaatggtgtactcgtgatctcgatt
ataccgacggaaggcgaacgttatcaaggtgtaatccaattagataaaccgaccattcgt
gaatgtttagaagattattttattcgttctgaacaactacaaacacatctaattattcga
gtgggcgaatatgctggtcaagcggttgcggcgggtatgctattacaaataatgcccgat
ggtacaggtacccccgaagattttgaacatctgatgacactagcagaaacggtgaaagac
gaagaattatttggcttaaccgcagaagcattgctctatcgtttattccatcaagaacaa
gttgaagtttatcctgcacaaacgaccgcattcaaatgtggctgttcacgagagcgttct
ggtcaggcaatgttattattgccaatggcagaaattgaggaaatgttagcagagaaaaag
ggagtaattgatatgcaatgcgaatgttgcggtacacaatatttctttgataaaccagcc
attatgttattaaaagaagaggcagctaaattagctgatttggggttaacataa

DBGET integrated database retrieval system