KEGG   Haemophilus ducreyi: HD_1723Help
Entry
HD_1723           CDS       T00135                                 

Gene name
tktA
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
hdu  Haemophilus ducreyi
Pathway
hdu00030  Pentose phosphate pathway
hdu01100  Metabolic pathways
hdu01110  Biosynthesis of secondary metabolites
hdu01120  Microbial metabolism in diverse environments
hdu01130  Biosynthesis of antibiotics
hdu01200  Carbon metabolism
hdu01230  Biosynthesis of amino acids
Module
hdu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hdu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HD_1723 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    HD_1723 (tktA)
Enzymes [BR:hdu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     HD_1723 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: AAP96482
UniProt: Q7VKY5
LinkDB All DBs
Position
1435764..1437761
Genome map
AA seq 665 aa AA seqDB search
MTERKVLANAIRFLSMDAVQKANSGHPGAPMGMADIAEVLWRDFLKHNPTNPKWADRDRF
VLSNGHGSMLIYSLLHLSGYDLSIEDLKQFRQLHSKTPGHPEYGYAPGVETTTGPLGQGI
TNAVGMAIAEKTLAAQFNREGHKIVDHYTYAFLGDGCLMEGISHEACSLAGTLGLGKLIA
FYDDNNISIDGHVDGWFADDTAQRFEAYGWQVIRNVDGHDATQIKIAIENAQAEKDRPTL
IICKTIIGYGSPNKSASHDCHGAPLGNGEIALTRQALNWQYAPFEIPADIYADWDAKAKG
CLIEKEWDAKFVAYQTAYPALAAEFKRRMAGDLPANWKTEASHFIETLQANPASIASRKA
SQNAIEAYAHLLPELLGGSADLASSNLTLWSGSKPIRADHNVDGNYINYGVREFGMSAIM
NGIALHGGFIPYGATFLMFYEYAHNAVRMAALMKQRALFVYTHDSIGLGEDGPTHQPVEQ
TASLRYIPNLETWRPCDQVESAIAWKSAIERQDGPTALIFTRQNLAQQARMAEQLANVAR
GGYVLKEASGTPDLILIATGSEVELAIKAAEVLENEGKKVRVVSMPSTNIFDKQSEAYRE
SVLPRAITKRIAIEAQLSDFWYKYVGFEGRIIGMNSFGESAPADQLFKLFGFSVENVVAK
AKEMW
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgtaaagtgctcgcgaatgcaattcgttttttaagtatggatgcagtacaa
aaagctaattcaggccaccccggtgcgccgatgggaatggctgatattgctgaagtatta
tggcgtgatttcttgaagcataatccgactaatcctaaatgggcagatcgcgaccgcttt
gtgctctccaacggtcatggctccatgttaatttatagtttattgcatttgagcggttat
gatctttcaattgaagatttaaaacaattccgtcaattgcactctaaaacacctggacat
cctgaatatggttatgcacccggtgtagaaacaacgaccggtccgttaggtcaaggtatt
actaatgcggtaggaatggccattgctgaaaaaacattagcggctcaatttaaccgtgaa
ggccacaaaattgttgatcattatacttatgcctttttaggtgatggctgtctaatggaa
ggtatttcacatgaagcttgttcattagcgggcacattaggtttaggtaaactaattgct
ttttatgatgataataatatttctatcgatggccatgtagatggttggtttgctgatgat
actgcacaacgttttgaagcctatggttggcaagtgattcggaatgtagatggacacgat
gcaacccaaatcaaaatagcgattgaaaatgcacaagcggaaaaagatcgcccaacgtta
attatctgtaaaacaattattggttatggttcaccaaacaaatctgcatcacacgattgc
cacggtgctccattaggtaatggggagattgcattaactcgccaagcattaaattggcaa
tatgcgccattcgaaattcctgcggatatctatgcagactgggatgctaaggcaaaaggt
tgcttaatcgaaaaagaatgggatgcaaaatttgttgcttatcagaccgcttatccagcg
cttgctgctgaatttaaacgccgtatggcgggtgatttaccggcaaattggaaaacagaa
gccagtcactttattgaaacattacaagctaatcctgcttcaattgcaagccgtaaagca
tcacaaaatgcgatcgaagcttatgcacatttattgcctgaacttttaggtggctctgca
gatttagccagttcaaacttaacgctttggtctggttcaaaaccaattcgtgcggatcat
aatgttgatgggaattatatcaattatggggttcgtgaattcggtatgtctgccattatg
aatggtattgcgttgcacggtggttttatcccttatggtgcgactttcttgatgttctat
gaatatgcacataatgctgtacgtatggcagcattaatgaaacaacgtgccttatttgtt
tatacccatgattctatcggtttaggagaagatggtccaacgcatcaacccgtagaacag
accgcttcattacgttacattccaaatttagaaacgtggcgcccttgtgaccaagttgaa
tcagccattgcgtggaaatccgctattgaacgtcaagatgggccaactgcattgatcttt
acacggcaaaatttagcacagcaggcgcgtatggcagaacaattagcgaatgttgctcgt
ggcggttatgtattgaaagaggcatctggcactccagatttaatcttaattgcgacagga
tctgaagtcgaacttgcaattaaagccgctgaagtgcttgaaaatgaaggtaaaaaagta
cgcgtagtgtcgatgccatcaacgaatattttcgataaacaaagcgaagcttatcgtgag
tcagtgttacctcgcgctatcaccaaacgcatagcgattgaagcacaattatctgatttc
tggtacaaatacgttggctttgaaggccgtattatcggtatgaatagttttggtgaatca
gcacctgcagatcaattattcaaattatttggttttagcgtggaaaacgtggtggccaaa
gcaaaagaaatgtggtaa

DBGET integrated database retrieval system