KEGG   Helicobacter pylori BM012A: U063_0449Help
Entry
U063_0449         CDS       T02939                                 

Definition
(GenBank) Cystathionine gamma-lyase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
heb  Helicobacter pylori BM012A
Pathway
heb00270  Cysteine and methionine metabolism
heb00450  Selenocompound metabolism
heb01100  Metabolic pathways
heb01110  Biosynthesis of secondary metabolites
heb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    U063_0449
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    U063_0449
Enzymes [BR:heb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     U063_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AHA87810
LinkDB All DBs
Structure
PDB: 

Position
complement(437277..438419)
Genome map
AA seq 380 aa AA seqDB search
MRMQTKLIHGGISEDATTGAVSVPIYQTSTYRQDAIGRHKGYEYSRSGNPTRFALEELIA
DLEGGVKGFAFASGLAGIHAVFSLLQSGDHVLLGDDVYGGTFRLFNQVLVKNGLSCTIID
TSDISQIKKAIKPNTKALYLETPSNPLLKITDLAQCAGVAKDHDLLTIVDNTFATPYYQN
PLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDSWLLQR
GIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNHELAKKQMRGFSGMLSFT
LKNDSEATLFVESLKLFILGESLGGVESLVGVPAFMTHACIPKEQREAAGIRDGLVRLSV
GIEHEQDLLEDLEQAFAKIG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgcaaacaaaactaatccatgggggcattagtgaggacgcgacaacgggggcg
gtgagcgtgcctatttatcaaacttccacctaccgccaagacgccataggtcgccataag
ggctatgaatactctcgctcaggaaaccccacgcgctttgctttagaagaactcatcgct
gatttagaagggggggttaaggggtttgcttttgcctctggcttagctggaatccacgcc
gttttttcccttttacaatcaggcgatcatgtgttgttaggcgatgatgtttatgggggg
actttccgcttgttcaatcaagtgcttgtcaaaaacgggctttcttgcaccattatagac
actagcgatatatcccaaatcaaaaaagccatcaagcccaacaccaaagccctttattta
gaaacccctagtaaccccttgcttaaaatcacggatttagcgcaatgcgctggtgtcgct
aaagatcatgatttgctcactatcgtggataacacctttgccaccccctattatcaaaac
ccgcttcttttgggagcggacattgtagtgcatagcggcaccaaatacttaggcggtcat
agcgatgtggtcgctgggcttgtaaccactaacaatgaagcgctagcccaagagatcgct
tttttccaaaacgctatcggtggggttttaggccctcaagacagctggctgttgcaaaga
gggattaaaacgctgggattacgcatgcaagcccatcaaaaaaacgctctttgtgtggct
gagtttttagaaaaacaccctaaagtagaaagggtttattacccaggccttcccactcac
cctaaccacgagctggccaaaaaacagatgcgtggctttagcgggatgctctctttcacc
ctcaaaaatgacagcgaggcgactctttttgtagaaagccttaaattattcattttaggc
gagagtttgggcggggtggaaagtttggtgggggttccagcgtttatgacccatgcgtgt
atccctaaagaacaacgagaagccgcagggattagagatggtctggtgcgcttgtctgtg
gggattgagcatgaacaggatttgttggaagatttagagcaagcgttcgctaaaataggc
taa

DBGET integrated database retrieval system