KEGG   Helicobacter pylori BM012A: U063_0535Help
Entry
U063_0535         CDS       T02939                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
heb  Helicobacter pylori BM012A
Pathway
heb00061  Fatty acid biosynthesis
heb00780  Biotin metabolism
heb01100  Metabolic pathways
heb01130  Biosynthesis of antibiotics
heb01212  Fatty acid metabolism
Module
heb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:heb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    U063_0535
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    U063_0535
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    U063_0535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:heb01004]
    U063_0535
Enzymes [BR:heb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     U063_0535
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     U063_0535
Lipid biosynthesis proteins [BR:heb01004]
 Fatty acid synthase
  Component type
   U063_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR DUF1509
Motif
Other DBs
NCBI-ProteinID: AHA87894
LinkDB All DBs
Structure
PDB: 

Position
524389..525216
Genome map
AA seq 275 aa AA seqDB search
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLTFTYLNESLEKRVRPIAQELNSPYV
YELDVSKEEHFKSLYDSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISV
YSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHH
IRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSHLSSGVS
GEVHFVDAGYHVMGMGAVEERDNKATLLWDLHKEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttaaaaggtaaaaaagggcttattgtaggggtggcgaacaataaatccatc
gcttatgggatcgctcaatcttgtttcaatcaaggggctactttgactttcacttatttg
aatgagagcttagaaaagcgcgtgaggcctatcgcgcaggaattgaatagcccctatgtg
tatgaattggatgtgagcaaagaagagcatttcaagtcgctatatgatagcgttaaaaag
gatttaggctcattggattttatcgttcatagcgtggcctttgcccctaaagaggcttta
gaggggagcttgctagaaacttctaaaagcgcgtttaacaccgctatggaaatttctgtt
tattctttaatagagctgacaaacaccctaaaacctttattgaataacggagcgtctgtt
ttgactttaagctatttgggcagcaccaaatacatggcgcattacaatgtgatggggttg
gctaaagcggccctagagagcgcggtgcgttatttagcggtggatttaggcaaacaccat
ataagagtgaatgccctatcggccgggcctattaggacgctcgcttctagcgggatcgct
gattttaggatgattttaaaatggaatgaaatcaacgcccctttaagaaaaaatgtgagt
ttagaagaagtgggcaatgctgggatgtatttgctctctcatctctctagtggggtgagt
ggggaagtgcattttgtggatgctggctatcatgttatgggcatgggggctgtggaagaa
agagataataaagctacgctattgtgggatttgcataaagaacaataa

DBGET integrated database retrieval system