KEGG   Helicobacter pylori BM012A: U063_1604Help
Entry
U063_1604         CDS       T02939                                 

Definition
(GenBank) Cell division protein FtsI
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
heb  Helicobacter pylori BM012A
Pathway
heb00550  Peptidoglycan biosynthesis
heb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:heb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    U063_1604
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    U063_1604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:heb01011]
    U063_1604
Enzymes [BR:heb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     U063_1604
Peptidoglycan biosynthesis and degradation proteins [BR:heb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   U063_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHA88932
LinkDB All DBs
Structure
PDB: 

Position
complement(1639334..1641100)
Genome map
AA seq 588 aa AA seqDB search
MKNLRYKLLLFVFIGFWGLLVLNLFILSVKNQEYYEKLAERNMTKKEFLVPTRGNITDRN
HEFLATNELVFGVFLPNGLKQKDLLEKIEIIQKFFPNFSKETLLNNYQKENSLYNHNLIK
VVGLIPYAAMQSLYTKLIQTQGIFALPLDKRYYPNNALASHVLGYVGVASLQDLKDDEEN
QYSQIVGKTGIEKEYNRLLQGKVGYKIMRVNALNQELATLEVVPPSTNNHLQLSLDKRLQ
KEADKLFENKRGAILVMDAENGELLVAGSYPEYNLNDFVGGISQDKWQKLQDDIYNPLLN
RFANALYPPGSVVKMGVGLSFLENLNITENTTIPTPPFIEVGKRKFRDWKKTGHGNSNLY
KAIRESVDVYFYKFGLEISIEKLSKTLREVGFGEKTGVDLPNEFVGIVPDNLWKLKRFNQ
DWRVGDTLITAIGQGSFLATPLQVLAYTGLIATGKLATPHFAINNKQPLKDPLNSFQKKK
LQALRVGMYEVCNHKDGTAYHSTRGSKVTLACKTGTAQVVEIAQNIVNRMKEKDMEYFHR
SHAWITAFLPYEKPKYAITILVEHGEGGSKLGGLLVKMSNKLYELGYL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcttcgctataagcttttgctttttgtttttatagggttttgggggttattg
gttttaaatttatttattttaagcgttaaaaatcaagaatactatgaaaaactggctgaa
cgaaacatgactaaaaaggaatttctagtccctacaaggggcaatattacagatagaaac
catgagtttttagctactaatgaattggtatttggcgtgtttttgcccaacggactgaaa
caaaaagatcttttggaaaaaattgaaatcatccaaaagtttttccctaacttttccaaa
gaaacgcttttaaacaattaccaaaaagaaaattcgctttataaccataacctcattaaa
gtggttggcctcattccttatgccgccatgcaatccctttataccaaactcatccaaact
caaggcatttttgctcttcccttagacaagcgttactaccctaataacgctttagcctcg
catgttttaggctatgtgggggtggcaagcttgcaagatttaaaagacgatgaggagaat
caatacagccagattgtgggcaaaaccggcattgaaaaagaatacaacaggcttttacaa
ggcaaggtgggctataaaatcatgcgcgtcaatgcgctcaatcaagaattagccacttta
gaagtagtgccgccaagcaccaacaaccacttgcaattgagtttagacaaacgcttgcaa
aaggaagcggataagctctttgaaaataaaaggggggctattttagtgatggatgcagaa
aatggggaattgctcgttgcaggaagttaccctgaatacaatttgaacgattttgtaggc
gggatcagtcaagacaaatggcaaaaacttcaagatgatatttataaccccctactaaac
cgcttcgctaacgctttgtatccgccgggatctgtggttaaaatgggcgtgggcttgagc
tttttagaaaaccttaatatcacagaaaacaccaccatacccacaccgccttttattgaa
gtgggcaagcgcaaattcagagactggaaaaaaacagggcatggcaattctaatttgtat
aaagccattagggagtccgtggatgtgtatttttataaatttgggcttgaaatctctata
gaaaaactctctaaaactttaagggaagtgggctttggggaaaaaacgggcgttgatttg
ccgaatgaatttgtggggattgtgccggataatttatggaaactcaaacgcttcaatcaa
gattggcgcgttggggacacgctcattaccgctattgggcaaggctcttttttagccacg
cctttgcaggttctagcctacacgggactcattgctacgggcaaactggcaacgcctcat
ttcgctatcaacaataaacagccgctcaaagatcccttaaatagctttcaaaaaaagaag
ctccaagccttgagagtgggcatgtatgaagtgtgcaaccataaagacggcaccgcttat
cattccacaaggggttctaaggttactttagcgtgtaaaaccggcaccgcacaagtcgtg
gaaatcgctcaaaacatcgtcaatcgcatgaaagaaaaggatatggaatatttccatcga
tcccatgcgtggattaccgcattcttgccttatgaaaaacccaaatacgctatcactatt
ttagtagaacatggggaaggggggtcaaaactagggggcttgttagtgaaaatgagcaat
aaactctatgaacttggctatctttaa

DBGET integrated database retrieval system