KEGG   Candidatus Hoaglandella endobia: TPER_HE00340Help
Entry
TPER_HE00340      CDS       T04484                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hed  Candidatus Hoaglandella endobia
Pathway
hed00061  Fatty acid biosynthesis
hed00780  Biotin metabolism
hed01100  Metabolic pathways
hed01212  Fatty acid metabolism
Module
hed_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hed00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TPER_HE00340 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TPER_HE00340 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hed01004]
    TPER_HE00340 (fabZ)
Enzymes [BR:hed01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     TPER_HE00340 (fabZ)
Lipid biosynthesis proteins [BR:hed01004]
 Fatty acid synthase
  Component type
   TPER_HE00340 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: CUX97260
UniProt: A0A143WU34
LinkDB All DBs
Position
I:complement(355633..356088)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRFPFLLVDRVLDFEKGQFLRAVKNVSFNEPLFQGHFPGKPI
FPGVLILEALAQATGILAFKSAGKLAPGELYYFAAIDKARFKRPVQPGDQMILEVEFIKE
RRGVARFKGIAKIDSEVACEASMMCARRPEA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcatattgaagagatattagaacttttacctcatcgc
tttccatttttactggtggaccgcgtactagattttgagaaaggacagtttctgcgggct
gtgaagaatgtatcctttaatgaacccttgttccagggccatttccctggaaagccaatt
tttcctggtgtgctaattttggaagctctggctcaggcaaccggtattctagcatttaag
agcgcgggcaagctagctccaggagaactctattatttcgcagctattgataaagcccgt
tttaaacgtccagtgcaacctggcgatcagatgattctcgaagtagaatttattaaagaa
cgtcgcggcgttgcccgttttaaaggtattgccaaaatagatagcgaagtagcttgcgaa
gcatctatgatgtgtgcccgtcgcccggaggcctga

DBGET integrated database retrieval system