KEGG   Herbaspirillum sp. meg3: hmeg3_02775Help
Entry
hmeg3_02775       CDS       T05024                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hee  Herbaspirillum sp. meg3
Brite
KEGG Orthology (KO) [BR:hee00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    hmeg3_02775
Enzymes [BR:hee01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     hmeg3_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like FAD_binding_3 DAO NAD_binding_8 Thi4 AlaDh_PNT_C Thioredoxin_4 K_oxygenase FMO-like Nif11
Motif
Other DBs
NCBI-ProteinID: ASU37327
UniProt: A0A223P5G4
LinkDB All DBs
Position
607632..609227
Genome map
AA seq 531 aa AA seqDB search
MLDANLKAQLKAYLEKVTQPIEIVASLDDGAKSRELQELLQEIVTLSERITLVERNDHAV
RKPSFSLNRPGTDISVQFAGIPMGHEFTSLVLALLQVGGHPIKLDDKVIEQIRNLDGDYT
FETYISLTCQNCPEVVQALNVMSIINPRIRSVTVDGALFQDEVEKRQIMAVPTVYMNGEV
FGQGRTGVEEILAKLDTGAAARKGEELSAKEAYDVLIVGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVLDTLAIENFVSVKETEGPQFATALEQHVRSYDVDIMNTQRAEALVPGNGLI
EVKLANGGVLKGKTVILSTGARWREVNVPGEREYRNHGVAYCPHCDGPLFKGKRVSVIGG
GNSGVEAAIDLAGIVSHVTLLEFAAELKADAVLVRKLKSLPNVTIVTSAQTTEITGDGKK
VNGISYKERVSGEVKHVELEGVFVQIGLVPNTEWLKGTVALSKHGEIEIDAKGQTSIPGV
FAAGDVTTVPYKQIVIAVGEGSKAALSAFDHLIRTSAPEEAPVAAKEAVAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaaagcccaattaaaagcctacctggaaaaggtcacgcagcct
atcgagatcgtcgcgtcgctggatgatggcgccaagtctcgtgagttgcaggagctgctg
caggaaatcgtcacgctgtccgagcgcattacgctcgtagaacgcaacgatcacgccgta
cgcaagccgtccttttcattgaatcgccccggtaccgatatcagcgtgcagttcgccggt
atcccgatgggccacgaatttacgtcgctggtgctggcgctgctgcaagtcggcggccac
ccaatcaaactcgacgacaaggtgatcgagcaaatccgcaatctggatggcgattacacc
tttgaaacctatatttcgctgacctgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgatcattaacccacgcatccgttcggtgaccgttgacggcgcgctgttccag
gacgaagtcgagaagcgccagatcatggccgtgccgaccgtctacatgaacggtgaagtg
ttcggccagggccgtaccggcgtggaagagatcctcgccaagctcgacaccggcgccgca
gcgcgcaagggtgaagagctgagcgccaaggaagcctacgacgtgctgatcgtcggcggt
ggcccggcaggtgccgcagctgcgatttatgcagcacgcaaaggcatccgcaccggtgtg
gttgcagaacgtttcggcggccaggtgctggacacgctggcgattgaaaacttcgtctcc
gtcaaggaaaccgaaggcccccaattcgccaccgcgctggaacagcacgtccgtagctac
gacgtcgatatcatgaacacgcaacgcgccgaagcactggtgccgggtaacggtctgatc
gaagtcaagctggccaacggcggcgtcctcaagggcaagaccgtgatcctctcgaccggt
gcacgctggcgcgaagtcaacgtgccgggcgagcgcgaataccgcaatcacggtgtcgct
tactgtccgcactgcgacggtccgttgttcaagggcaagcgcgtgtctgtcatcggcggc
ggcaactccggcgtggaagcggcaatcgacctggccggcatcgtcagccacgttacgctg
ctggaattcgccgcggaactgaaagccgatgccgtgctggtgcgcaagctgaagagcctg
cctaacgtcaccatcgtgacctcggcgcaaaccaccgagatcaccggcgacggcaagaag
gtcaacggtatcagctacaaggaacgcgtcagcggtgaagtgaagcatgtcgaactggaa
ggtgttttcgtccagatcggtctggtgccgaacaccgaatggctcaagggtacggttgct
ctgtccaagcacggcgaaattgaaatcgacgccaagggccagacttcgattcctggcgtg
ttcgcagcaggcgacgtgacaacggtgccgtacaagcagatcgtgatcgctgttggtgaa
ggctccaaagcagcgctgagcgctttcgatcacctgatccgcacttcggctcccgaagaa
gcaccggttgcagcaaaagaagctgtcgcagcctga

DBGET integrated database retrieval system