KEGG   Herbaspirillum sp. meg3: hmeg3_03385Help
Entry
hmeg3_03385       CDS       T05024                                 

Definition
(GenBank) ferredoxin
Organism
hee  Herbaspirillum sp. meg3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_7 Fer4 Fer4_2 Fer4_9 Fer4_16 Fer4_10 GF_recep_IV Fer4_4 Fer4_21 Fer4_6 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ASU37434
UniProt: A0A223P5Z7
LinkDB All DBs
Position
736223..736480
Genome map
AA seq 85 aa AA seqDB search
MALMITDDCINCDVCEPECPNEAIYMGPQIYEIDPNKCTECVGHFDEPQCQQVCPVACIP
FDPAWRESKEQLMVKYETLQAGAKA
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggcactgatgatcactgatgattgcattaactgcgacgtctgcgagcctgagtgcccg
aacgaagcgatctacatggggccgcagatctatgaaatcgaccccaacaaatgcaccgaa
tgcgtcggccatttcgatgagccgcaatgccagcaagtctgcccggtcgcctgcattccc
ttcgatccggcctggcgcgaatccaaggaacaactgatggtcaagtacgaaaccctgcaa
gccggggccaaggcctga

DBGET integrated database retrieval system