KEGG   Herbaspirillum sp. meg3: hmeg3_12005Help
Entry
hmeg3_12005       CDS       T05024                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hee  Herbaspirillum sp. meg3
Pathway
hee00250  Alanine, aspartate and glutamate metabolism
hee00410  beta-Alanine metabolism
hee00640  Propanoate metabolism
hee00650  Butanoate metabolism
hee01100  Metabolic pathways
hee01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hee00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    hmeg3_12005 (gabT)
   00650 Butanoate metabolism
    hmeg3_12005 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    hmeg3_12005 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    hmeg3_12005 (gabT)
Enzymes [BR:hee01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     hmeg3_12005 (gabT)
Amino acid related enzymes [BR:hee01007]
 Aminotransferase (transaminase)
  Class III
   hmeg3_12005 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASU41406
UniProt: A0A223PH62
LinkDB All DBs
Position
2697824..2699143
Genome map
AA seq 439 aa AA seqDB search
MTSVTQVTSAKAASNSELQARKNAATPRGVGVMCDFYADRALNAELWDVEGRRYIDFAAG
IAVLNTGHRHPKLMQAISAQMERFTHTAYQIVPYASYVELAERINAITPGEHAKKTALFS
TGAEAVENAIKIARAATGRAAVIAFSGAFHGRTMMGMALTGKVAPYKLGFGPFPGEVYHA
PFPTALHGVSTDDALAAVNGLFKSDVDPKRVAAIIIEPVQGEGGFYAAPVEFMRGLRKIC
DEHGILLIADEVQTGFARTGKLFAMEHYDVLPDLMTMAKSLAGGMPLAAVCGRAEVMDAP
APGGLGGTYAGNPLAVASALAVLDVIAEESLVVRGARLGSALKDFLIGLGANTPAIGEVR
GLGAMVAVEFVEPGTDKPDAEFAKRVQGNALKSGLLLLTCGSYGNVIRFLFPLTIPDTVM
DEALVILEKAILDAHIANA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccgtcacacaagttacttcggccaaggccgcctccaatagcgaactgcaggct
cgcaagaacgccgccacgccacgcggcgtcggtgtgatgtgcgacttttacgctgatcgt
gccctcaatgccgagctgtgggatgtcgaaggccgccgttatatcgacttcgccgccggc
atcgccgtattgaataccggtcatcgccatcccaagctgatgcaagcgatcagcgcccag
atggagcgtttcacccataccgcctatcagatcgtcccgtatgcgagctatgtcgagttg
gcagaacgtatcaacgccatcacgcccggcgagcacgccaagaagaccgcgctgttcagc
accggcgcagaggcagtggaaaacgccatcaagattgcccgcgcggccaccgggcgcgcc
gccgtcatcgccttctcgggggctttccacgggcgcacgatgatgggcatggcgctgacc
ggcaaggttgcgccttacaaactgggtttcggtcctttccccggcgaggtgtatcacgcg
cccttccctacggcgctgcatggcgtgagcactgatgatgcgctggcggcagtcaacggc
ttgttcaaaagcgacgtcgatccgaagcgtgtggcggccatcattattgaaccggtgcaa
ggcgaaggcggcttctatgccgcgccggtagagttcatgcgcggtttgcgcaaaatctgc
gacgagcacggcatcctgctgattgccgatgaagtgcaaaccggttttgcgcgtaccggt
aaattatttgcaatggaacattacgacgtcctgcctgacctgatgacgatggccaagagt
ctggcaggtggtatgccgctggcggccgtctgcggccgtgccgaggtgatggatgcaccg
gcgccaggcggtctgggcggcacatacgccggcaaccccttggcggtcgcctcggccctg
gcggtgctggatgtcattgcggaagaaagcctggtggtgcgcggtgcgcgcctgggttct
gcgctgaaggatttcctgatcggcctgggcgccaacacgccagccatcggtgaagtacgt
ggccttggcgcgatggtcgcggtggaattcgtcgaacccggcaccgacaagccggatgcg
gaattcgccaagcgcgtgcagggcaatgccttgaaaagcggtttgctgctgctgacctgc
ggcagctacggcaatgtgattcgcttcttgtttccgctgacgattccggataccgtcatg
gacgaagcgctggtcattctggagaaggcgatcctcgacgcacacatcgccaacgcctga

DBGET integrated database retrieval system