KEGG   Herbaspirillum sp. meg3: hmeg3_22000Help
Entry
hmeg3_22000       CDS       T05024                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hee  Herbaspirillum sp. meg3
Pathway
hee00473  D-Alanine metabolism
hee00550  Peptidoglycan biosynthesis
hee01100  Metabolic pathways
hee01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    hmeg3_22000
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    hmeg3_22000
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    hmeg3_22000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hee01011]
    hmeg3_22000
Enzymes [BR:hee01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     hmeg3_22000
Peptidoglycan biosynthesis and degradation proteins [BR:hee01011]
 Precursor biosynthesis
  Amino acid ligase
   hmeg3_22000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp TTL ATPgrasp_ST CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ASU40711
UniProt: A0A223PFK0
LinkDB All DBs
Position
complement(4880665..4881690)
Genome map
AA seq 341 aa AA seqDB search
MTDSNMAKQFGKVGVLFGGRSAEREVSLMSGEGVLKALRSKGVDAHPFDPAQRSLAELAA
EKFDRVFIALHGRYGEDGTLQGALEQLGIPYTGPGVMASSIAMDKVMTKRIWIGHDLPTP
RFIVLDSAATPREELRQVPDVLGLPLMLKAPHEGSTIGIAKVAGYSDMQEAFNLCAKYDA
AVLAEEFVTGRELTVPVLGKGRDAKAYPVIEIRAPEGNYDYQHKYFTDDTKYLCPAPIDE
ALTRRVQDLAEKAYNALGCRGWSRVDFMLRASDNEPFLLEINTSPGMTSHSLVPMSAKQA
GMSYEDLCCEILKSAALDLKPSDAWKPHASTDAGANVSDKG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacggactcgaatatggccaaacaattcggtaaggtcggcgtgctgttcggcggtcgc
tccgccgagcgcgaagtctcgctgatgtccggcgagggcgtgttgaaggccttgcgcagc
aagggtgtcgacgcacatcctttcgatccggcgcagcgcagcctggctgaactggctgca
gaaaaatttgatcgcgtctttatcgcgctgcacggtcgctacggcgaagacggtacgctg
caaggtgcgctggagcagctcggcattccttacaccggtcccggcgtgatggcgtcctcg
attgcgatggacaaggtcatgaccaagcgcatctggatcggccatgacttgccgacgccg
cgctttatcgtgcttgacagcgctgctacgccgcgcgaagagttgcgtcaggttcccgac
gtactcggtttgccgctgatgttgaaggcgccgcacgaaggttcgaccatcggtatcgcc
aaagtggcgggttattccgacatgcaggaggcattcaacctgtgcgccaaatacgacgct
gctgtgttggcggaagaatttgtcaccggccgcgaactgacggtgccggtgctgggcaaa
ggacgtgatgcaaaggcttatccggtaatcgagatccgcgcacccgaaggcaattacgac
tatcagcacaagtatttcaccgacgacaccaagtatctgtgcccggcgccgatcgacgaa
gccctgacgcggcgcgtgcaggatcttgccgagaaggcgtataacgcactcggttgccgc
ggctggtcgcgcgtggacttcatgctgcgcgcgtccgacaacgagccgttcctgctggag
atcaatacctcgccaggcatgaccagccattcgctggtgccgatgtcggccaagcaggcg
ggaatgagttacgaagatttgtgctgcgagattttgaaatccgcagcgctggatttgaag
ccgtccgacgcgtggaaaccgcacgcttcgaccgatgccggcgccaacgtttcggacaag
ggataa

DBGET integrated database retrieval system