KEGG   Herbaspirillum sp. meg3: hmeg3_23380Help
Entry
hmeg3_23380       CDS       T05024                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hee  Herbaspirillum sp. meg3
Pathway
hee00020  Citrate cycle (TCA cycle)
hee00480  Glutathione metabolism
hee01100  Metabolic pathways
hee01110  Biosynthesis of secondary metabolites
hee01120  Microbial metabolism in diverse environments
hee01130  Biosynthesis of antibiotics
hee01200  Carbon metabolism
hee01210  2-Oxocarboxylic acid metabolism
hee01230  Biosynthesis of amino acids
Module
hee_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hee_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    hmeg3_23380
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    hmeg3_23380
Enzymes [BR:hee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     hmeg3_23380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH B12-binding_2
Motif
Other DBs
NCBI-ProteinID: ASU41619
UniProt: A0A223PHQ6
LinkDB All DBs
Position
complement(5182971..5185205)
Genome map
AA seq 744 aa AA seqDB search
MTTDKSTIIYTLTDEAPLLATYSLLPIIRTFTAQVGVDVVESDISVATRILAEFPDRLTP
EQRVPDNLAALGKLTQDPSANIIKLPNISASVPQLQAAVRELQSRGYAIPDVPEDPKTDE
EKEILKSYSKVLGSAVNPVLREGNSDRRAPASIKRFARKHPHSMGEWSMASRSHVAHMKH
GDFYHGEKSMTIGAARDVKMELVGKSGKVTVLKPKVSLKAGEIIDSMFMSKKALCDFYEE
QFEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHGKLFDELGVNVNNGLV
NLYEKIETLPSSKKEEIIRDLHACHEHRPSLAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWDANGKPQDTKAVIPESTFARIYQEVINFCKTNGNFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDLATGEVLLTQNVEQGDIWRMCQVKDEPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDHDTKGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDMGIKTGNKKAQVLAKALDDATGKLLDNNQSPSPKTGELDNR
GSHFYLAMYWAQELAAQKDDAELAAKFAPLAKTLTENEAKITAELKAVQGKPVDIGGYFM
ADPKKVSEVMRPSATFNAALSSVK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagataaatccaccatcatctatacgcttactgacgaggcgccgctgctggcg
acgtactccctcctgccgatcatccgaaccttcaccgcacaggtgggcgtcgatgtcgtg
gaaagcgatatttcggtggcgacgcgtattctggccgaattcccggaccgtctgacacct
gaacagcgtgtcccggacaatctggccgcgctgggcaagctgacgcaagatccaagcgcc
aacatcatcaagctgccgaacatcagcgcctcggtgccgcagttgcaagccgccgtgcgt
gaactgcaatcgcgtggttatgccatccctgatgtgccggaagatccaaagaccgacgaa
gaaaaagaaatcctgaagagctactccaaagtgctcggcagcgccgtgaacccggttctg
cgtgaaggcaactccgatcgccgcgcaccggcatcgatcaagcgcttcgcacgcaagcac
ccgcacagcatgggcgagtggagcatggcatcgcgctcgcacgttgcccacatgaagcat
ggcgacttctaccacggtgaaaaatccatgaccatcggcgccgcgcgcgacgtcaagatg
gaactggtcggcaagagcggcaaggtcaccgtcctgaaaccgaaggtttccctgaaggcc
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctgtgcgatttctacgaagag
caattcgaagatgcgcgcaagaccggcgtcatgctgtcgctgcacgtcaaggcaaccatg
atgaaggtgtcgcacccgatcgtgttcggccacgccgtcaagatcttctacaaggaagcg
tttgccaagcacggcaagctgttcgacgaactgggcgtgaacgtcaacaacggcctggtc
aacctgtacgaaaaaatcgaaacactgccatcgtcgaagaaggaagaaatcatccgtgac
ctgcacgcttgtcacgagcatcgtccatcgctggcgatggttgattcggccaagggtatt
tccaacctgcacgcaccgaacgacgtgatcgtcgatgcatcgatgccggccatgatccgt
atcggcggcaagatgtgggatgccaacggcaagccgcaagacaccaaggcagtgatcccg
gaaagcacctttgcccgtatctaccaggaagtcatcaacttctgcaaaaccaacggcaac
ttcgatccgaccaccatgggcaccgtgcctaacgtcggtctgatggcgcaaaaggcggaa
gagtacggttcgcacgacaagacatttgaaatcgctgaagacggcgttgccaacatcgtc
gacctggcaacaggcgaagtgctgctgacacaaaacgtcgagcaaggcgacatctggcgc
atgtgccaggtcaaggacgaaccgatccgcgactgggtcaaactggccgtcacccgcgca
cgcaactccggcatgccggcagtattctggctcgacccgtaccgtccgcacgaagcagaa
ctgatcaagaaggttgagacttacctgaaggatcacgacaccaagggcctggacatccag
atcatgtcgcaagtgcgcgccatgcgttacacgctggaacgcgtcatccgcggcctggac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgttccgctgatggctggtggcggcatg
tacgaaacaggcgcaggcggttcggcgccgaagcacgtcaagcaactggtggaagaaaac
catctgcgctgggactcgctcggtgaattcctggcgttggccgtgtcgctggaagacatg
ggcatcaagaccggcaacaagaaggcacaggttctggccaaggcgttggatgacgccacc
ggcaaactgctggataacaaccagtcgccatcgccaaagaccggtgagctggacaatcgc
ggcagccatttctacctggccatgtactgggcgcaagaactggcagcgcaaaaggacgac
gccgaactggcagccaagtttgcgccgctggccaagacactgacagagaacgaagccaag
atcactgcagaactcaaggcagtgcaaggcaagccggtcgacatcggcggctatttcatg
gccgacccgaagaaggtcagcgaagtcatgcgtcctagcgcgactttcaatgcagcactg
agcagcgtcaagtaa

DBGET integrated database retrieval system