KEGG   Helicobacter pylori F16: HPF16_0625Help
Entry
HPF16_0625        CDS       T01910                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hef  Helicobacter pylori F16
Pathway
hef00473  D-Alanine metabolism
hef00550  Peptidoglycan biosynthesis
hef01100  Metabolic pathways
hef01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hef00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPF16_0625 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPF16_0625 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HPF16_0625 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hef01011]
    HPF16_0625 (ddl)
Enzymes [BR:hef01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPF16_0625 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hef01011]
 Precursor biosynthesis
  Amino acid ligase
   HPF16_0625 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_TupA RimK GARS_A VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: BAJ55222
UniProt: E6NDL2
LinkDB All DBs
Position
complement(626372..627415)
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEYEISIVSAIALKEALKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI
KEKKLPPLILTHNGLLKSSFLGAKTIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKYLTKLYAKDLGVKALDYVLLNEKNCANALNLIGFNFPFIIKPSNAGSSLG
VSVVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYVEEPNKQEF
LDFKQKYLDFSRNKAPKANLSSALEEQLKENFKKLYNDLFDGALIRCDFFVIENEVYLNE
INPIPGSLANYLFDDFKTTLENLAQSLPKTPKIPIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggaattttgcgttttatttggtggggcgagttttgagtatgaaatcagcattgtgagt
gcgatcgcgcttaaagaagcgctaaaggataggattaaatactttatttttttagatgaa
aaccatcatttttacttgattgaagaatccaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattaccccccctaatccttacgcataatggcttgcttaagagctcgttt
ttaggtgctaagactatagaattgcctttagtgatcaatcttgtgcatgggggcgatggc
gaagatgggaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgttgagttataacaaatatttaaccaagctttacgccaaagactta
ggggtaaaggctttagattatgttcttttgaatgaaaaaaactgcgctaacgctctaaat
ttgattggctttaattttcctttcatcatcaagcccagtaacgccggtagctctttaggg
gtgagcgttgtgaaagaagaaaaagaattgatttacgctttagacggcgcgtttgaatat
tctaaagaggtcttaatagagcctttcattcagggagtgaaagaatacaatttagccggt
tgcaagatcaaaaaggatttttgtttttcctatgttgaagagcctaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaacaaagcccctaaagcgaatctt
tctagcgccctagaagaacaattgaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgcttattcgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttggctaattatttgtttgatgattttaaaacaacgcta
gaaaatttagcgcaatcattacccaaaacccctaaaatcccaatcaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system