KEGG   Helicobacter pylori Gambia94/24: HPGAM_01590Help
Entry
HPGAM_01590       CDS       T01917                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
heg01100  Metabolic pathways
heg01110  Biosynthesis of secondary metabolites
heg01130  Biosynthesis of antibiotics
heg01230  Biosynthesis of amino acids
Module
heg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:heg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPGAM_01590 (aroB)
Enzymes [BR:heg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     HPGAM_01590 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 DUF3294
Motif
Other DBs
NCBI-ProteinID: ADU81164
UniProt: E8QKM0
LinkDB All DBs
Structure
PDB: 

Position
307603..308634
Genome map
AA seq 343 aa AA seqDB search
MQEILIPLKEKSYKVFLGELPEIKLKQKALIISDSIVAGLHLPYLLERLKALEVRVCVIE
SGEKYKNFHSLERILNNAFEMQLNRHSLMIALGGGVISDMVGFASSIYFRGIDFINIPTT
LLAQVDASVGGKTGINTPYGKNLIGSFHQPKAVYMDLAFLKTLEKREFQAGVAEIIKMAV
CFDKNLVEILETKDLKDCLEEVVFQSVSIKAQVVVQDEKEQNIRAGLNYGHTFGHAIENE
TNYEQFLHGEAIAIGMRMANDLALSLGMLTLKEYERIENLLKKFDLIFNYQITDLQKFYE
RLFLDKKSENQTLKFILPKGVGAFEIASHIPKETILKVLEKWH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatcttaatccctttaaaagaaaaaagctataaagtgtttttgggggaactg
cctgaaataaaattgaaacaaaaagcgctcatcattagcgatagcatcgtggccgggttg
catttaccctatttattagagcgcttgaaagccttagaagtcagagtgtgcgtgatagag
tccggggaaaaatacaaaaacttccattcgttagagcggattttaaacaacgcctttgaa
atgcaattaaaccgccattctttaatgatagcccttggtgggggagtcataagcgatatg
gtggggtttgcgagcagtatttatttcagggggattgattttattaatatccctacgact
ttactcgctcaagtggatgcgagcgtgggagggaaaacagggatcaatacgccttatggt
aagaacttaatcggatcgttccaccagcctaaagcggtttatatggatctagctttttta
aaaacccttgaaaaaagggaatttcaagcaggggttgctgaaatcattaaaatggcggtg
tgttttgataaaaacttggtagaaatattagaaacaaaggatttaaaagattgtttagaa
gaggtggtttttcaaagcgtcagtatcaaagctcaagtcgttgttcaagatgaaaaagag
caaaatatcagggccgggttgaactatgggcatacctttgggcatgcgatagaaaacgag
accaattacgagcaatttttgcatggcgaagcgatcgctattggcatgcgcatggctaat
gatttagccctttctttaggcatgctcactctaaaagaatacgaacgcatagaaaattta
ttgaaaaaatttgatctgatattcaattaccaaatcactgatcttcaaaaattttacgaa
cgcttgtttttagacaaaaaaagcgagaaccaaaccctaaaattcattctgcctaaaggc
gttggagcgtttgagattgcctctcatatccctaaagaaacgattttaaaggtgttagaa
aaatggcattaa

DBGET integrated database retrieval system