KEGG   Helicobacter pylori Gambia94/24: HPGAM_03815Help
Entry
HPGAM_03815       CDS       T01917                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00473  D-Alanine metabolism
heg00550  Peptidoglycan biosynthesis
heg01100  Metabolic pathways
heg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:heg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPGAM_03815 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPGAM_03815 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HPGAM_03815 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:heg01011]
    HPGAM_03815 (ddl)
Enzymes [BR:heg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPGAM_03815 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:heg01011]
 Precursor biosynthesis
  Amino acid ligase
   HPGAM_03815 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_TupA GARS_A RimK VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: ADU81586
UniProt: E8QM43
LinkDB All DBs
Position
777211..778254
Genome map
AA seq 347 aa AA seqDB search
MDFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEELNMHSKYFAQI
KEKKLPPLTLTRNGLLKNSFLGAKTIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
VEASVLSYNKYLTKLYAKDLGVKALDYALLNEKNRANALDLIGFNFPFIVKPSNAGSSLG
VNVVKEEKELVYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKTDFCFSYVEEPNKQEF
LDFKQKYLDFSRTKAPKANLSNALEEQLKENFKKLYNDLFDGAIIRCDFFVIENEVYLNE
INPIPGSLANYLFDDFKTTLEHLAQSLPKTPKIQVKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggatttttgcgttttatttggtggggcgagttttgagcatgagatcagcattgtgagt
gcgattgcgcttaaaggggtgttaaaagataggattaaatattttatttttttagatgaa
aaccatcatttttacttgattgaagaattaaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattaccccccctaaccctcacgcgcaatggcttgcttaaaaactcgttt
ttaggcgctaaaacgatagaattgcctttagtgatcaatcttgtgcatgggggcgatggc
gaagacgggaaattagcgagcttgttagaattttatcgcatcgctttcataggtcctagg
gttgaagcgagcgtgctgagttataacaaatatttaaccaaactttacgctaaagattta
ggggtaaaggctttagattatgcgcttttgaatgaaaaaaaccgcgctaacgccttggat
ttgattgggtttaatttcccttttattgtcaaacccagtaacgccgggagctctttaggg
gtgaatgttgtgaaagaagaaaaagaattggtttacgctttggatagtgcgtttgaatat
tctaaagaagttttaatagagcctttcattcagggcgtgaaagaatacaatttagccggc
tgtaagatcaaaacggatttttgtttttcctatgtggaagagcctaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaccaaagcccctaaagcgaacctt
tctaacgccctagaagaacaattaaaagagaattttaaaaaactctataacgatttgttt
gatggcgcgatcatccgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttggcgaattatttgtttgatgattttaaaacaacgcta
gaacatttagcacaatcgttacccaaaacccctaaaatccaagttaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system