KEGG   Helicobacter pylori Rif2: C730_00445Help
Entry
C730_00445        CDS       T02318                                 

Definition
(GenBank) type II restriction enzyme R protein (hsdR)
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
hei  Helicobacter pylori Rif2
Brite
KEGG Orthology (KO) [BR:hei00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:hei02048]
    C730_00445
Enzymes [BR:hei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     C730_00445
Prokaryotic defense system [BR:hei02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    C730_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C Chordopox_A15
Motif
Other DBs
NCBI-ProteinID: AFV44499
LinkDB All DBs
Position
97257..98090
Genome map
AA seq 277 aa AA seqDB search
MKNHLPFDIFLKSLKTSNRTLDFFTDWQKCLKNKNKISIALNHLNFLLGKDTKELKNCIK
SLFKEYPKAFNVLNILIAVRDKKDIVLDANGNFYPLYSYFEDGEKVYEFIRQTGLERIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKVMENHLSGLFTNAQLNFKEQVEIREFEDLCQ
AFGDDIKKFDFVVCGKDKTYFIEANFYTISGSKLNEVARSYQDLALKFEAFPNYEFIWIT
DGIGWLDAKNKLQEAYKSVEIYNLSNVNDFISKAQKW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccatctgccttttgatatttttttaaaaagtcttaagacaagcaataggact
ttagattttttcaccgattggcaaaagtgcctcaaaaataaaaataaaataagcatcgct
ttaaaccacttgaattttttacttgggaaagatacaaaagagcttaaaaattgcattaag
agtctttttaaagaataccccaaagcttttaatgttttaaatattctcattgctgtgagg
gataaaaaggatatagtgcttgatgctaatggcaatttttaccccttatattcttatttt
gaagatggtgaaaaagtttatgagtttattcgtcaaacggggttggagcgaattttttgt
aacagaaatattaaagatttaaatgattttgtttttggtatagaagtggggcttgatagc
aatgcgagaaaaaatcgcagcggaaaagttatggaaaatcatcttagcggtctttttacg
aacgctcaattaaattttaaagaacaagtagagattagagaatttgaggatttatgccaa
gcttttggagatgatattaaaaaatttgattttgttgtttgtggtaaagataaaacttat
tttatagaagctaatttttatactattagtgggagtaagcttaatgaagtcgcaagatcc
tatcaagacttagctttaaaatttgaagcattccccaattacgaatttatttggataacc
gatggcataggttggctggacgctaaaaacaaactccaagaagcttacaaatctgtagag
atctacaatttgagcaatgtaaatgattttatatcaaaggcacaaaaatggtaa

DBGET integrated database retrieval system