KEGG   Helicobacter pylori Rif2: C730_05725Help
Entry
C730_05725        CDS       T02318                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hei  Helicobacter pylori Rif2
Pathway
hei00010  Glycolysis / Gluconeogenesis
hei00020  Citrate cycle (TCA cycle)
hei00620  Pyruvate metabolism
hei00640  Propanoate metabolism
hei00650  Butanoate metabolism
hei00680  Methane metabolism
hei01100  Metabolic pathways
hei01110  Biosynthesis of secondary metabolites
hei01120  Microbial metabolism in diverse environments
hei01130  Biosynthesis of antibiotics
hei01200  Carbon metabolism
Module
hei_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C730_05725 (porA)
   00020 Citrate cycle (TCA cycle)
    C730_05725 (porA)
   00620 Pyruvate metabolism
    C730_05725 (porA)
   00640 Propanoate metabolism
    C730_05725 (porA)
   00650 Butanoate metabolism
    C730_05725 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    C730_05725 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    C730_05725 (porA)
Enzymes [BR:hei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     C730_05725 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFV45508
LinkDB All DBs
Position
1171132..1172355
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGTMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaattgcaagagatagaagtgtgggatggcaataccgctagttct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattatggctcgtttaaggataatggctatgttgatggcgaattcgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgccgcagctggaggg
agagtcagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggaatgcgtttgcctatcgttttgaatttagtcaatcgtgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagggattctggttggataagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttaccaattcgtgggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgccatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcacaggcaggcaataccatttaacc
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattccttgcgccccttcccttatgaaagattagggcaggatttgaaaaatcttaaa
gctttagcgattttagacaagagctctccagcgggcactatgggggcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacgatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system