Halomonas elongata: HELO_1023 Help Entry HELO_1023         CDS       T01311                                  Symbol zapA Name (GenBank) cell division protein ZapA   KO K09888   cell division protein ZapA Organism hel  Halomonas elongata Brite KEGG Orthology (KO) [BR:hel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hel03036]     HELO_1023 (zapA) Chromosome and associated proteins [BR:hel03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HELO_1023 (zapA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapA ADIP Motif Other DBs NCBI-ProteinID:  CBV40906 UniProt:  E1V469 LinkDB All DBs Position complement(29304..29603) Genome browser AA seq 99 aa AA seqDB search MSDSSRPTIEITLLERQYVIACPPDEESKLERAARYLDRAMQGIHAQGKVVDREKVAIMA ALNIANELLETQDEQRAGEQSLSELSQRLEKALADAPGR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagcgactcttcacggcccaccatcgagatcaccctgctggaacggcagtacgtcatt gcctgtccgccggacgaggaaagcaagctcgaacgcgcggcgcgctacctggaccgcgcc atgcagggcatccacgcccagggcaaggtggtcgaccgcgagaaggtcgccatcatggcg gccctgaacatcgccaacgagttgctcgagacccaggatgaacaacgcgccggcgagcag agcctgagcgagctcagccagcgactggagaaggcgcttgccgacgctcccggccgttga

DBGET integrated database retrieval system