KEGG   Halomonas elongata: HELO_1758Help
Entry
HELO_1758         CDS       T01311                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
hel  Halomonas elongata
Pathway
hel00071  Fatty acid degradation
hel00280  Valine, leucine and isoleucine degradation
hel00281  Geraniol degradation
hel00310  Lysine degradation
hel00362  Benzoate degradation
hel00380  Tryptophan metabolism
hel00410  beta-Alanine metabolism
hel00640  Propanoate metabolism
hel00650  Butanoate metabolism
hel00903  Limonene and pinene degradation
hel00930  Caprolactam degradation
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
hel01120  Microbial metabolism in diverse environments
hel01130  Biosynthesis of antibiotics
hel01200  Carbon metabolism
hel01212  Fatty acid metabolism
Module
hel_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HELO_1758 (fadB)
   00650 Butanoate metabolism
    HELO_1758 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HELO_1758 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HELO_1758 (fadB)
   00310 Lysine degradation
    HELO_1758 (fadB)
   00380 Tryptophan metabolism
    HELO_1758 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HELO_1758 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HELO_1758 (fadB)
   00281 Geraniol degradation
    HELO_1758 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HELO_1758 (fadB)
   00930 Caprolactam degradation
    HELO_1758 (fadB)
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HELO_1758 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HELO_1758 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HELO_1758 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     HELO_1758 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CBV41642
UniProt: E1V879
LinkDB All DBs
Position
884602..886785
Genome map
AA seq 727 aa AA seqDB search
MIYQGNAISVARDDEGIATLTFDLKDESVNKLSSAVVQELEQALEALRGESDIAGLVLAS
AKDAFIVGADITEFHGLFAKGEDEIQSMLEQVHGIFNGLEDLPFPTVSAINGLALGGGCE
VTLATDFRVMSETAKIGLPETKLGILPGWGGCVRLPRLIGADNAIEWIAGGTENRADACL
SVGAVDAVVPPESLEAAARDILNRARSGELDYQARRTEKCSPLGLDAIEQMMAFETAKGY
VAGKAGPHYPAPIEAIKVIQKGAGEERARAQAIEAKAFGKLALTDVCYNLVGLFLNDQVV
KKKGGQYAKQSVPVERAGVLGAGIMGGGIAYQSASKGTPILMKDIKDEAIELGLKEARKL
FAKQVERGKLSNEQMAERLSNIRPTLSYGDFSHVDLVVEAVVENPKVKGAVLAEVEENVS
EDTILTSNTSTISITRLAENLKRPENFCGMHFFNPVHRMPLVEVIRGEKTGDGAVAATVA
YARKMGKTPIVVNDCPGFLVNRVLFPYFGGFSQLMAAGADFQRVDRVMEKFGWPMGPAYL
LDVVGMDTAVHAGEVMAEGFPERMGSLGGAGSEGKSAIQVMFDNERLGQKNAKGFYAYEE
DKKGKPRKVRDEAAIELVKGIAESGREFSDEDIIARMMTPLCLETVRCLEDGIVGTPAEA
DMALIYGIGFPPFRGGALRYIDAMGLEAFVAQADELAAELGALYAPTDRLREMARNGERF
YQDAAEA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggcaatgccatctcggtggcgcgcgatgacgagggcatcgcgaccctg
accttcgacttgaaggatgagtcggtcaacaagctgtccagcgctgtggtccaggaactg
gaacaggcgctggaagcgctgcgtggcgaatccgacatcgcaggcctggtgctggccagt
gccaaggacgccttcatcgtcggcgccgacatcaccgagttccacggtttgttcgccaag
ggcgaggacgagattcagagcatgctcgagcaggtgcacgggatcttcaacggtctcgag
gacctgcctttccccacggtcagcgccatcaacggcctggctctggggggcggctgcgag
gtgacgttggccaccgattttcgcgtgatgagcgagaccgccaagatcggcctgcccgag
accaagctcggcatcctgcccggctggggtggctgcgtgcgtctgccgcggctgatcggc
gccgacaacgccatcgagtggatcgccggtggcaccgagaatcgcgccgatgcctgcctg
tcggtcggcgcggtcgacgccgtggtgccgcccgagtctctcgaggcagcggcgcgcgac
attctgaatcgggcccggagcggcgaactcgattaccaggcacgtcgcacggaaaaatgc
agccccctgggcctcgacgccatcgagcagatgatggccttcgagacggccaagggctat
gtggccggcaaggccggaccgcattacccggcgccgatcgaggcgatcaaggtcatccag
aagggagccggcgaggagcgcgcccgggcccaggccatcgaagccaaggcgttcggcaag
ctggcgctcaccgatgtctgctacaacctggtgggcctcttcctcaacgatcaggtggtc
aagaaaaagggcggtcagtacgcgaagcaatcggtgcccgtggagcgggccggggtgctc
ggcgcgggtatcatgggcggcggcatcgcctatcagagcgcctccaagggcacgccgatc
ctgatgaaggacatcaaggacgaggccatcgaactggggctcaaggaggcccgcaagctg
ttcgccaagcaggtggagcgcggcaagctctccaacgagcagatggccgagcggctcagc
aacatccggccgacgctttcctatggcgatttctcccacgtcgacctggtggtcgaggcg
gtggtcgagaatcccaaggtcaagggggcggtgctcgccgaggtcgaggagaacgtgagc
gaggacaccatcctcacctccaatacctcgaccatctcgatcacccggctcgccgagaac
ctgaagcggcccgagaatttctgcggcatgcacttcttcaacccggtgcatcgcatgccg
ctggtcgaggtcattcgcggtgaaaagaccggcgacggtgccgtggccgcgaccgtggcc
tatgcccgcaagatgggtaagacgcccatcgtggtcaatgactgcccgggctttctggtc
aaccgcgtgctcttcccctatttcggcggcttcagccaactgatggccgccggggccgac
ttccagcgcgtcgacagggtgatggagaagttcggttggccgatgggcccggcctatctg
ctcgacgtggtgggcatggataccgccgtgcacgccggtgaggtgatggccgaaggcttc
ccggagcgcatgggcagcctgggcggtgccgggagtgagggcaagagcgccatccaggtg
atgttcgacaatgagcgtctggggcagaagaacgccaagggcttctatgcctacgaagag
gacaagaagggcaagcccaggaaggtccgcgacgaggcggccatcgagctggtcaagggc
attgccgagtcgggccgcgagttttccgacgaggacatcatcgcgcggatgatgacgcct
ctgtgcctggagaccgtgcgttgcctggaggatggcatcgtcggcacgccggccgaggcc
gacatggcgctgatctatggcatcggcttcccgccgttccggggtggtgcgctgcgctat
atcgacgccatggggctggaggcgttcgttgcccaggccgacgagctggccgccgaactc
ggggctctctacgcgccgaccgacaggctgcgcgagatggcgcgcaacggcgagcgtttc
tatcaggatgccgccgaggcctga

DBGET integrated database retrieval system