KEGG   Halomonas elongata: HELO_3046
Entry
HELO_3046         CDS       T01311                                 

Gene name
rlmKL
Definition
(GenBank) ribosomal RNA large subunit methyltransferase RlmKL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
hel  Halomonas elongata
Brite
KEGG Orthology (KO) [BR:hel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hel03009]
    HELO_3046 (rlmKL)
Enzymes [BR:hel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     HELO_3046 (rlmKL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     HELO_3046 (rlmKL)
Ribosome biogenesis [BR:hel03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HELO_3046 (rlmKL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 Methyltransf_25 Methyltransf_31 Methyltransf_11 THUMP Methyltransf_24 Phi-29_GP4
Other DBs
NCBI-ProteinID: CBV42930
UniProt: E1V4J2
LinkDB
Position
complement(2398129..2400330)
AA seq 733 aa
MIDRRSTAPGAYLATCPKGLEALLSDELAALGAEPTKTTVAGVYFQAELVTAYRACLWSR
LANRVVRCLIQEDGVETPERLREASAGVDWQAHLAVGSTLAVDFHGRSDAIRHTRFGAQT
VKDGVVERLQADGCARPRVDPQAPDLRLYANLHRGRLTLGIDLSGESLHRRGYRRGTGHA
PLKENLAAALLIRAGWPAMAREGAPLVDPLCGAGTLLIEAAMMAADMAPNLQRERFGFHG
WVGHDEASWRELKREAEARASIGRKRCRNRLFGFDRSPPALAAAKSNAMRAGIPALIELT
GGALGELERPGGLDEAPPGLIITNPPYGERLGELPELVELYAQLGERARAAFPGWRLALF
TANPDLGHRTGLRAHKQYSLKNGPLDARLLLMDIPSGTDEEKGEATSKPSRSEGAQMFAN
RLLKNRKRLNKWLKRSGESCYRLYDADMPEYALAIDVYGDRVHVQEYAPPRSVDPGQAQK
RLHEALGVIPEVLGVEPSQVVIKQRQRQSGRAQYQRQDTSGERFEVREGRARLWVNLRDY
LDTGLFLDHRPVRRLLAELAEGKRFLNLFCYTAAATVQAALGQDEGRGASDSVSVDLSNT
YLDWARENFRLNRLDPSRHRVVRDDCFHWLETAGSEFDVIFLDPPTFSNSKKMTDTLDVQ
RDHGRLVRLAMARLAPGGTLVFSNNQRRFKLDADLAEAFVVEDISAKTFDPDFKRRPDLH
HCFLIRHRDGEEA
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgatcgatagacgatccaccgcccccggggcgtatctggctacctgccccaaggggctc
gaagcgttgttgtccgatgagctggccgcgctcggcgccgagccgaccaagacgacggtg
gccggtgtgtacttccaggccgagctggtcacggcgtatcgcgcttgcttgtggtcgcga
ctggccaatcgcgtggtgcgttgcctgatccaggaggacggtgtagagaccccggaacgg
ctgcgtgaggccagcgcaggtgtcgactggcaggctcacctggccgtcggctcgaccctg
gcggtggacttccatgggcgcagcgatgccatccgccacacgcgcttcggggcccagacc
gtcaaggatggtgtggtcgagcgactgcaggccgatggctgcgcgcgaccccgggtcgac
cctcaggcgcccgacctgcgtctttacgcgaacctgcatcgcggtcgtcttacgctgggg
atcgacctgtcgggcgagagcctgcatcggcgcggctatcgacgcggcacgggacacgca
ccgctcaaggagaacctggcggcggccctgctgattcgtgccggctggccggcgatggcc
cgggagggagctccgctcgtcgatcccctgtgtggcgctggcaccctgttgatcgaggcc
gcgatgatggccgctgacatggcgcccaacctgcagcgcgaacgtttcggctttcatggc
tgggtcggtcatgatgaggccagctggcgcgaactcaagcgcgaggccgaggcccgggcg
agcatcggccgcaagcgttgccgcaaccggttgttcggtttcgatcgcagtccgccggca
ctggcggcggccaagtccaacgccatgcgggcggggattccggccttgatcgagctgacc
gggggcgcgctcggtgagctcgagcgtcccggagggctggatgaggcgcccccgggcctg
atcatcaccaaccccccttatggcgaacggctgggcgaactgccggaactcgtcgagctg
tacgcccaactgggcgagcgggcccgtgcggccttcccgggctggcgcctggcgctgttc
accgccaatcccgacctcggtcatcgcacggggctgcgtgcccacaagcagtattcgctg
aagaacggtcctctggatgcgcgcctgttgctgatggacatcccgtccgggacggacgaa
gagaagggcgaggcgacgagcaagccgtctcgcagcgaaggcgcccagatgttcgccaat
cgcctgctgaagaatcgcaagcgattgaacaagtggctgaagcgatccggtgaaagctgc
tatcggctttatgacgccgacatgcccgagtatgcgctggccatcgatgtctatggggat
cgcgtgcatgtgcaggaatatgcgccgcctcgttccgtggatcccggccaggcgcagaag
cgtctgcatgaagcgctcggcgtgatacccgaggtgctcggcgtggagccttcccaggtg
gtgatcaagcaacgccagcgtcagagcgggcgggctcagtaccagaggcaggataccagt
ggcgagcgtttcgaggtccgggagggccgggcgcggctatgggtcaatctgcgcgactat
ctggatacaggactcttcctcgaccatcgtcccgtgcgtcgcctgctggccgagctggcc
gagggcaagcgctttctcaatctgttctgctacacggccgccgctaccgtgcaggccgcg
ctcggccaggacgaagggcggggtgccagcgacagcgtcagtgtcgatctttccaacacc
tacctcgactgggcccgggagaacttccgcctgaaccggctggatccctcgcggcatcgc
gtggtgcgcgacgactgcttccattggctggagactgccggcagtgagttcgatgtgatc
tttctcgatccgccgaccttctccaactccaagaagatgaccgatactctcgacgtgcaa
cgcgatcacggtcggctggtgcggctggccatggcgagactggcacccggcggcaccctg
gtgttctccaacaaccagcggcgcttcaagctggatgccgacctggccgaggccttcgtc
gtggaagatatctcggcgaagaccttcgatcctgacttcaagcgtcgcccggacttgcac
cattgtttcctgatccgacatcgtgacggggaagaggcgtaa

DBGET integrated database retrieval system