KEGG   Halomonas elongata: HELO_4329Help
Entry
HELO_4329         CDS       T01311                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hel  Halomonas elongata
Brite
KEGG Orthology (KO) [BR:hel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HELO_4329 (ahpF)
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HELO_4329 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin K_oxygenase Thi4 FMO-like AlaDh_PNT_C FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CBV44213
UniProt: E1VBQ6
LinkDB All DBs
Position
complement(3897942..3899498)
Genome map
AA seq 518 aa AA seqDB search
MLDDNLKSQLNAYLQKVTRPFEIVATLDDGDKSRELHTLLQEVAGLSDKITLREDGDDAR
APSFALYREGESTGVVFAGIPMGHEFTSLVLALLQVGGHPPKASDETIEQIKSLPEGLHF
ETYFSQSCQNCPDVVQALNLMAVLNPGISHVAIDGALFKDEVEAREVMSVPGIFLNGEPF
DQGRMSLEQILAKVDNGAQEREAEKLNAMPAFDLLTVGGGPAGAAAAVYAARKGIRTGVA
AERFGGQVLDTLGIENLISVPYTEGPKLAAALEEHVKQYDVDIMNLQRAVELVPASEPGG
EHEVRFASGASLKSRTLVLATGARWREMNVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGLVKEVVLIEFMDELRADEVLQNKLASLPNVEIIKGARTTQINGDG
AKVSGLTYEERASGELRDIELEGVFVQIGLVPNTEWLRDSSIELSAHGEIITDERGMTSV
PGIFAAGDVTTVPYKQIVISLGEGSRAALGAFDYLIRQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaatctgaaatcccagctcaatgcctatctccagaaggtcacgcggccg
ttcgagatcgtcgccaccctcgatgacggcgacaagtcccgagaactgcacaccttgctg
caggaagtcgcgggcctgagcgacaagatcacactccgcgaggatggcgacgatgcccgt
gcgccgtccttcgccctgtaccgcgagggggagtccaccggcgtggtgttcgccggcatc
cccatgggccacgaattcacctcgctggtcctggcactgctgcaggtgggcggacacccg
cccaaggcgagcgacgagacgatcgagcagatcaagtcgctgcctgagggcctgcacttc
gagacctatttctcgcagtcctgccagaactgcccggacgtggtgcaggcgctgaacctg
atggcggtcctcaaccccggcatcagccatgtggccatcgatggcgccctgttcaaggac
gaggtcgaggcccgcgaggtgatgtcggtacccggcatcttcctcaatggcgagcccttc
gatcagggccgcatgagcctcgagcagatcctggccaaggtggacaacggcgctcaggag
cgcgaggccgagaagctcaacgccatgccggccttcgacctgctgaccgtgggcggtggc
ccggcgggtgccgcggcggccgtctatgcggcgcgcaagggcattcgcactggcgttgcc
gccgagcgtttcggcggccaggtactcgataccctgggtatcgaaaacctgatctcggtg
ccctataccgaaggccccaagctggccgcggcgctggaagagcacgtcaagcagtacgac
gtcgacatcatgaacctccagcgggccgtcgagctggtgcctgccagcgagcccggcggt
gagcacgaggtgcgtttcgcctcgggcgcgagcctcaagagccgtaccctggtactggcc
accggtgcccgctggcgggaaatgaacgtgccgggcgaggccgagtaccgcaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgtgtggcggtgatc
ggcggcggcaactccggcgtcgaggcggccatcgacctggccggcctggtcaaggaagtc
gtcctgatcgagttcatggacgagctgcgcgccgacgaggtgctgcagaacaagctcgcc
agcctgcccaatgtcgagatcatcaagggcgcgcggacgacccagatcaatggtgatggg
gcgaaggtttccggcctcacctatgaggagcgcgccagcggcgaactccgcgatatcgag
ctggaaggcgtcttcgtgcagatcggcctggtgccgaacaccgagtggctgcgcgactcg
tccatcgagctttccgcgcatggcgagatcatcaccgacgagcgcggcatgacctcggtg
ccgggtatcttcgctgccggcgacgtgaccaccgtgccctacaagcagatcgtcatctcg
ctgggcgaaggctcgcgggcggccttgggcgccttcgactacttgatccgccagtaa

DBGET integrated database retrieval system