KEGG   Helicobacter pylori UM298: K748_03445Help
Entry
K748_03445        CDS       T02757                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
hem  Helicobacter pylori UM298
Pathway
hem00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hem01100  Metabolic pathways
hem01110  Biosynthesis of secondary metabolites
hem01130  Biosynthesis of antibiotics
hem01230  Biosynthesis of amino acids
hem02024  Quorum sensing
Module
hem_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    K748_03445
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    K748_03445
Enzymes [BR:hem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     K748_03445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AGR62498
LinkDB All DBs
Position
complement(421172..422521)
Genome map
AA seq 449 aa AA seqDB search
MSNTTWSPASWHSFKIEQHPTYKDKQELERVKKELHSYPPLVFAGEARNLQERLAQVIDN
KAFLLQGGDCAESFSQFSANRIKDMFKVMMQMAIVLTFAGSIPIVKVGRIAGQFAKPRSN
ATEILDNEEVLSYRGDIINGISKKEREPKPERMLKAYHQSVATLNLIRAFAQGGLANLEQ
VHRFNLDFVKNNDFGQKYQQIADRITQALGFMQACGVEIEKTPILREVEFYTSHEALLLH
YEEPLVRKDSLTNQFYDCSAHMLWIGERTRDPKGAHVEFLRGVCNPIGVKIGPNASVSEV
LELCDVLNPHNIKGRLNLIVRMGSKMIKERLPKLLQGVLKEKRHILWSIDPMHGNTVKTS
LGVKTRAFDSVLDEVKSFFEIHRAEGSLASGVHLEMTGENVTECIGGSQAITEEGLSCHY
YTQCDPRLNATQALELAFLIAGMLKKQRS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacaacttggtcgcccgcttcatggcattcttttaagatagagcaacacccc
acttataaagataagcaagaattagaaagggtcaaaaaagaattgcactcttaccctccc
ttagtgtttgctggcgaagcgaggaacttgcaagagcgcttagcccaagtcattgacaat
aaggcgtttttgttgcaagggggcgattgcgcggagtcgttttcccaatttagcgccaac
aggattaaagacatgtttaaagtgatgatgcaaatggcaattgtcttaacttttgctggc
tctataccgatcgtgaaagtggggcgcattgctgggcaatttgccaagcctcgctctaat
gcgactgaaatattagataatgaagaagtgttgagttatagaggggatattatcaacggg
atttccaaaaaagaaagagagccaaagcctgaaagaatgcttaaagcctaccatcaaagc
gtagcgactttaaaccttatcagagcctttgctcaaggtgggttagcaaatttagagcaa
gtgcatcgtttcaatttggattttgtcaaaaacaacgattttgggcagaaataccagcaa
atcgctgaccggatcacgcaagctttagggtttatgcaagcatgcggggtggagatagaa
aaaacgcctattcttagggaagtggaattttacaccagccacgaagcgttactgctccat
tatgaagagcctttggtgcgtaaggatagtttgactaaccagttttatgattgctccgcg
cacatgctgtggattggtgaaaggacaagagatcctaagggtgcgcatgtggagttttta
aggggggtttgtaaccctattggcgtgaaaatcgggcctaatgcgagcgtgagcgaagtg
ttagaattgtgcgatgttttaaaccctcacaacattaaggggcgtttgaatctgatcgtg
cgtatgggttctaagatgattaaagagcgtttgcctaagcttttacaaggggtgttgaaa
gaaaaacgccatattttatggagcattgatcccatgcatggcaacacggttaaaaccagt
ttgggggttaaaacaagggcttttgatagcgtgttagatgaagtgaaaagcttttttgaa
atccatagggctgaagggagtttggcttcaggggttcatttggaaatgacaggtgagaat
gttacagaatgcatcggtggctcgcaagcgatcactgaagagggtttgagctgtcattac
tatacgcaatgcgatccaaggctaaacgccacccaagccctagagctcgctttcttaatc
gctggcatgctcaaaaaacaacgatcttga

DBGET integrated database retrieval system