KEGG   Helicobacter pylori UM298: K748_03515Help
Entry
K748_03515        CDS       T02757                                 

Definition
(GenBank) restriction endonuclease MboI
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
hem  Helicobacter pylori UM298
Brite
Enzymes [BR:hem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     K748_03515
Prokaryotic defense system [BR:hem02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    K748_03515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C
Motif
Other DBs
NCBI-ProteinID: AGR63311
LinkDB All DBs
Position
432520..433353
Genome map
AA seq 277 aa AA seqDB search
MKNHLPFDTFLKSLKTSNRTLSFFTDWQKCLKNKNEISIALNHLNFLLGKGVQELKSCVK
SLFEEYPKAFNTLNILIAVMNKDEVVLDADGNFYPLHSYFENDEKVYQFICQTGLDQIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKAMENHLSGLFFQAQLNFKEQVDIREFEDLYQ
AFGDDIKKFDFVVYGKDKIYFIEANFYTISGSKLNEVARSYQELALKFEAFPNYEFIWIT
DGIGWLDAKSKLQEAYKSVEIYNLSNVNDFISKVQKW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccatttgccttttgatacttttttaaaaagtcttaagacaagcaataggact
ttaagctttttcaccgattggcaaaagtgcctcaaaaataaaaatgaaataagcatcgct
ttaaatcatttgaattttttgttggggaaaggtgtgcaagaacttaaaagttgcgttaag
agtctctttgaagaataccccaaagcttttaatactttaaatattctcattgctgtgatg
aataaagatgaggtagtgcttgatgctgatggcaatttttaccccctacattcttatttt
gaaaatgatgaaaaggtttatcaattcatctgtcaaacagggttggatcaaattttttgt
aacagaaacattaaagatttaaatgattttgtttttggtatagaagtggggcttgatagc
aatgcaagaaaaaatcgcagcggaaaggctatggaaaatcatcttagcggtctttttttt
caagctcaattaaattttaaagaacaagtagatattagagaatttgaggatttataccaa
gcttttggagatgatattaaaaaatttgattttgttgtttatggtaaagataaaatttat
tttatagaagctaatttttatactattagtgggagtaagcttaatgaagtcgcaagatcc
tatcaagaattagctttaaaatttgaagcattccccaattacgaatttatttggataacc
gatggcataggttggctagacgctaaaagcaaacttcaagaagcttacaaatctgtagaa
atctacaatttgagcaatgtaaatgattttatatcaaaggtgcaaaaatggtaa

DBGET integrated database retrieval system