KEGG   Helicobacter pylori SNT49: HPSNT_03815Help
Entry
HPSNT_03815       CDS       T01916                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00473  D-Alanine metabolism
hen00550  Peptidoglycan biosynthesis
hen01100  Metabolic pathways
hen01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hen00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPSNT_03815 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPSNT_03815 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HPSNT_03815 (ddl)
Enzymes [BR:hen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPSNT_03815 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hen01011]
 Precursor biosynthesis
  Amino acid ligase
   HPSNT_03815 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_TupA RimK GARS_A VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: AEN16913
UniProt: G2MEF1
LinkDB All DBs
Structure
PDB: 

Position
784926..785969
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIVLKGVLKDRIKYFIFLDENHYFYLIEESNMHSKYFAQI
KEKKLPPLTLVHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKYLTKLYAKDLGVKTLDCVLLNEKNRANALDLMNFNFPFIIKPNNAGSSLG
VSVVKEEKELVYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYVEEPNKQEF
LDFKQKYLDFSRTKAPKANLSGALEEQLKENFKKLYNDLFDGAIIRCDFFIIENEVYLNE
INPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggagttttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagc
gcgattgtgcttaaaggagtgttaaaagataggattaaatattttatttttttagatgaa
aaccactatttttatttgattgaagaatccaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattaccccccctaacccttgtgcacaatggtttgcttaaaaactcgttt
ttaggtgctaagattatagaattgcctttagtgatcaaccttgtgcatgggggcgatggc
gaagacgggaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgctgagttataacaaatatttaaccaagctttatgctaaagactta
ggggtaaagactttagattgcgttcttttgaatgaaaaaaaccgtgctaacgccctggat
ttgatgaactttaattttcctttcataatcaagcctaataacgccgggagctctttaggg
gtgagcgtggtgaaagaagaaaaagaattggtttacgctttagacggcgcgtttgaatat
tctaaagaggtcttaatagagcctttcattcaaggggtgaaagaatacaatttggccggt
tgtaagatcaaaaaggatttttgtttttcctatgttgaagagcctaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaccaaagcccctaaagcgaatctt
tctggcgctctagaagaacaattaaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgatcattcgttgcgatttttttatcatagaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttggccaattatttgtttgatgattttaaaacaacgcta
gaaaatttagcgcaatcattacccaaaacccctaaaatccaaatcaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system