KEGG   Helicobacter pylori 26695: C694_00970Help
Entry
C694_00970        CDS       T02282                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00061  Fatty acid biosynthesis
heo00780  Biotin metabolism
heo01100  Metabolic pathways
heo01130  Biosynthesis of antibiotics
heo01212  Fatty acid metabolism
Module
heo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:heo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C694_00970
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C694_00970
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    C694_00970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:heo01004]
    C694_00970
Enzymes [BR:heo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     C694_00970
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     C694_00970
Lipid biosynthesis proteins [BR:heo01004]
 Fatty acid synthase
  Component type
   C694_00970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR DUF1509
Motif
Other DBs
NCBI-ProteinID: AFV41415
UniProt: O24990
LinkDB All DBs
Structure
PDB: 

Position
201708..202535
Genome map
AA seq 275 aa AA seqDB search
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYV
YELDVSKEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISV
YSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHH
IRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVS
GEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttaaaaggtaaaaaagggcttattgtaggggtggcgaacaataaatccatc
gcttatgggatcgctcaatcttgtttcaatcaaggggctactttggctttcacttatttg
aatgagagtttagaaaagcgcgtaaggcctatcgcgcaggaattgaatagcccctatgtg
tatgaattggatgtgagcaaagaagagcatttcaagtcgctatacaatagcgttaaaaag
gatttaggctcattggattttattgttcatagcgtggcctttgcccctaaagaggcttta
gaggggagcttgttggaaacttctaaaagcgcgtttaacaccgctatggaaatttctgtt
tattctttaatagagctgacaaacaccctaaaacctttattgaataacggagcgtctgtt
ttgactctaagctatttgggtagcaccaaatacatggcgcattacaatgtgatggggttg
gctaaagcggccctagagagtgcggtgcgttatttagcggtggatttaggcaaacaccat
ataagagtgaatgccctatcggccgggcctattaggacgctcgcttctagcgggatcgct
gattttagaatgattttaaaatggaatgaaatcaacgcccctttaagaaaaaatgtgagt
ttagaagaagtgggcaatgccgggatgtatttgctctctagtttgtctagcggggtgagt
ggggaagtgcattttgtggatgctggctatcatgttatgggcatgggggctgtggaagaa
aaagataataaagctacgctactgtgggatttgcataaagaacaataa

DBGET integrated database retrieval system