KEGG   Helicobacter pylori 26695: C694_03790Help
Entry
C694_03790        CDS       T02282                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00473  D-Alanine metabolism
heo00550  Peptidoglycan biosynthesis
heo01100  Metabolic pathways
heo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:heo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    C694_03790 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C694_03790 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    C694_03790 (ddl)
Enzymes [BR:heo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C694_03790 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:heo01011]
 Precursor biosynthesis
  Amino acid ligase
   C694_03790 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_TupA RimK GARS_A VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: AFV41951
UniProt: P56191
LinkDB All DBs
Structure
PDB: 

Position
792991..794034
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI
KEKKLPPLILTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKYLTKLYAKDLGVKTLDHVLLNEKNRANALDLMNFNFPFIIKPNNAGSSLG
VNVVKEEKELVYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYVEEPNKQEF
LDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGAIIRCDFFVIKNEVYLNE
INPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggagttttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagc
gcgatcgcgcttaaaggagtgttaaaagataggattaaatattttatttttttagatgaa
aaccatcatttttatttgattgaagaatccaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattacctcccctaatcctcacacacaatggcttgcttaaaaactcattt
ttaggtgctaagattatagaattgcctttagtgatcaatctcgtgcatgggggcgatggc
gaagatgggaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgctgagttataacaaatatttaaccaagctttacgccaaagactta
ggggtaaagactttagatcatgttcttttgaatgaaaaaaaccgcgctaacgccttggat
ttgatgaactttaatttccctttcataatcaagcctaataacgccggaagctctttaggg
gtgaatgttgtgaaagaagaaaaagaattggtttacgctttagacggtgcgtttgaatat
tctaaagaggtcttgatagagcctttcattcagggagtgaaagaatacaatttggccggt
tgcaagatcaaaaaggatttttgtttttcctatgtggaagagcctaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaataaagcccctaaagcgaatctt
tctaacgccctagaagagcaattaaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgatcattcgttgcgatttttttgtcataaaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttggccaattatttgtttgatgattttaaaacaacgcta
gaaaatttagcgcaatcattacccaaaacccctaagatccaaatcaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system