KEGG   Helicobacter pylori 26695: C694_04845Help
Entry
C694_04845        CDS       T02282                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00473  D-Alanine metabolism
heo01100  Metabolic pathways
heo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:heo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C694_04845 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    C694_04845 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:heo01011]
    C694_04845 (alr)
Enzymes [BR:heo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     C694_04845 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:heo01011]
 Precursor biosynthesis
  Racemase
   C694_04845 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFV42154
LinkDB All DBs
Position
complement(1001204..1002292)
Genome map
AA seq 362 aa AA seqDB search
MLKRASFVEVDTASLRHNFSAVKSIVPKDACVMAVVKANAYGAGAIKASEIFLQEGANYL
GVATLDEALELRSHFSKTPILILGYSPNANASMLVDNDLSAMIFSLEQAEVFSQMALKSQ
KRLKVHIKIDTGMHRLGLEPNFKSIETIKKIRALKGLEIEGIFTHLSNADAKIKTHAKNQ
MKAFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNGNENRLLNLYRPGIMLYGFYPSNGMK
ESCPTILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRALGN
RIQVAINNQLAPLIGKVCMDQCFVKLNNIQAKEGDEVILFGDKSAKANDASEIXCAFKHH
CL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtggataccgcttctttaaggcataattttagc
gcagtcaaaagcattgtccctaaagacgcttgtgtcatggcggttgtcaaggcgaacgct
tatggggcaggagcgattaaagcgagcgaaattttcttacaagaaggggctaattattta
ggggtagcgaccttagatgaagctttagagttgcgttctcatttttctaaaacccccatt
ttgatcttaggctatagccctaatgctaacgcttccatgctggttgataacgatttgagc
gctatgatttttagccttgaacaagcggaagttttttctcaaatggctttaaaatctcaa
aaacgcttaaaagtgcacatcaaaattgataccggcatgcaccgcttgggtttagagcct
aattttaaaagcatagaaaccattaaaaaaatccgcgctttaaaaggtttggaaatagag
gggatatttacgcatttaagcaacgctgatgctaagattaaaacccatgctaaaaaccaa
atgaaagcctttaacgcttttttagagcagcttttggatcaaaaaatagagttccaatac
cgccatgcttataattctgccggtatcctttctttgtgtaacgggaatgaaaatcgtttg
ttaaacctttatcgcccaggcatcatgctctatggtttttacccctctaatggaatgaaa
gaatcatgcccaaccatcttaaaaaatgttatcagtttgaaagcgcaaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcgagcatttttataccaatgaagag
actttagtgggtgttttagctctagggtatgcagacgggttaatgcgcgctttaggcaat
cgcattcaagtagcgatcaataaccaattagcccccctgattggcaaggtgtgcatggat
caatgttttgtcaaactcaataatattcaagccaaagagggcgatgaggtcattttgttt
ggggataaaagcgctaaggctaatgacgcgagcgaaatcgyctgcgcttttaaacaccat
tgcttatga

DBGET integrated database retrieval system