KEGG   Helicobacter pylori 26695: C694_08110Help
Entry
C694_08110        CDS       T02282                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
heo  Helicobacter pylori 26695
Pathway
heo00550  Peptidoglycan biosynthesis
heo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:heo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C694_08110
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C694_08110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:heo01011]
    C694_08110
Enzymes [BR:heo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C694_08110
Peptidoglycan biosynthesis and degradation proteins [BR:heo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   C694_08110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF4709
Motif
Other DBs
NCBI-ProteinID: AFV42789
UniProt: O26085
LinkDB All DBs
Structure
PDB: 

Position
complement(1647293..1649059)
Genome map
AA seq 588 aa AA seqDB search
MKNLRYKLLLFVFIGFWGLLALNLFILSVKNQEYYEKLAERNMTKKEFLVPTRGNITDRN
DEFLATNELVFGVFLPSGLKQKDLLEKIEIIQKFFPNFSKETLLNNYQKENSLYNHNLIK
VVGFIPYATMQPLYAKLIQTQGIFALPLDKRYYPNNALASHVLGYVGVASLQDLKDDEEN
QYSQIVGKTGIEKEYNKLLQGKVGYKIMRVNALNQELATLEVVLPSTNNHLQLSLDKRLQ
KEADKLFENKRGAILVMDAENGELLVAGSYPEYNLNDFVGGISQDKWQKLQDDIYNPLLN
RFANALYPPGSVVKMGVGLSFLENLHITENTTIPTPPFIEVGKHKFRDWKKTGHGNSNLY
KAIRESVDVYFYKFGLEISIEKLSKTLREVGFGEKTGVDLPNEFVGIVPDNLWKLKRFNQ
DWRVGDTLITAIGQGSFLATPLQVLAYTGLIATGKLATPHFAINNKQPLKDPLNSFQKKK
LQALRVGMYEVCNHKDGTAYHSTRGSKITLACKTGTAQVVEIAQNIVNRMKEKDMEYFHR
SHAWITAFLPYEKPKYAITILVEHGEGGSKLGGLLVKMSNKLYELGYL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcttcgctataagcttttgctctttgtttttatagggttttgggggttacta
gccttaaatttatttattttaagcgttaaaaatcaagaatactatgaaaaattggctgaa
cgaaacatgactaaaaaggaatttctagtccctacaaggggaaatattacagacagaaat
gatgagtttttggccactaatgaattggtgtttggcgtgtttttgcccagcggactgaaa
caaaaagatcttttagaaaaaattgaaatcatccaaaagtttttccctaacttttctaaa
gaaacgcttttaaacaattaccaaaaagaaaattcgctttataaccataacctcattaaa
gtggttggcttcattccttatgccaccatgcaacctctttatgccaaactcatccaaact
caaggcatttttgcgcttcccttagacaagcgttactaccctaataacgctttagcttcg
catgttttaggctatgtgggggtggcaagcttgcaagatttaaaagacgatgaggagaat
caatacagccagattgtaggcaaaaccggcattgaaaaagaatacaacaagcttttacaa
ggcaaggtgggttataaaatcatgcgtgtcaatgcgctcaatcaagaattagccacctta
gaagtagtgctgccaagcaccaacaaccacttgcaattgagtttagacaaacgcttgcaa
aaagaagcggacaagctctttgaaaataaaaggggggctattttagtgatggatgcagaa
aatggggaattgctcgttgcaggaagttaccctgaatacaatttgaacgattttgtaggc
gggatcagtcaagacaaatggcaaaaacttcaagatgatatttataaccccttattaaac
cgcttcgctaacgccttgtatccgccgggatctgtggttaaaatgggcgtgggcttgagc
tttttagaaaaccttcatatcacagaaaacaccaccatacccaccccgccttttattgaa
gtgggcaagcacaaattcagagactggaaaaaaacagggcatggcaattctaatttgtat
aaagccattagggagtccgtggatgtgtatttttataagtttgggcttgaaatctctata
gaaaaactctctaaaaccttaagggaagtgggctttggggaaaaaacgggcgttgatttg
ccgaatgaatttgtggggattgtgccggataatttgtggaaactcaaacgcttcaatcaa
gactggcgcgttggggacacgctcattaccgctattgggcaaggctcttttttagccacg
cccttgcaggttctagcctacacgggactcattgctacgggcaaactggcaacgcctcat
ttcgctatcaacaacaaacaaccgcttaaagatcccctaaatagctttcaaaaaaagaag
ctccaagccttgagagtgggcatgtatgaagtgtgtaaccataaagacggcaccgcttat
cattccacaaggggttctaagattactttagcgtgtaaaaccggcaccgcacaagtcgtg
gaaatcgctcaaaacatcgtcaatcgcatgaaagaaaaggatatggaatatttccatcga
tcccatgcgtggattaccgcatttttgccttatgaaaaacccaaatacgctatcactatt
ttagtagaacatggggaaggggggtcaaaactagggggcctgttagtgaagatgagtaat
aaactctatgagcttggctatctttaa

DBGET integrated database retrieval system