KEGG   Helicobacter pylori Puno120: HPPN120_04635Help
Entry
HPPN120_04635     CDS       T01919                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00473  D-Alanine metabolism
hep01100  Metabolic pathways
hep01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPPN120_04635
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HPPN120_04635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hep01011]
    HPPN120_04635
Enzymes [BR:hep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPPN120_04635
Peptidoglycan biosynthesis and degradation proteins [BR:hep01011]
 Precursor biosynthesis
  Racemase
   HPPN120_04635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEN15540
UniProt: G2M5Z6
LinkDB All DBs
Position
complement(943803..944936)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNNASLRHNFSAVKSIVPKDAHIMAVVKANAYGAGAIKASEIFLQEGAHYL
GVATLDEALELRSHFSKTPILILGYSPNANASMLIDNDLSAMIFSLEQAEVFSQMALKSQ
KRLKIHLKIDTGMHRLGLEPNFKSIETIKKICALKGLEVEGIFTHLSNADAKIKTHAKNQ
MKAFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNGNENRFLNLYRPGIMLYGFYPSNGMK
ETCPTILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRDLGN
RIQVAINNQLAPLIGKVCMDQCFVKLNNIQAKEGDEVILFGDKSAKANDASEIAALLNTI
PYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaataacgcttctttaaggcataattttagc
gcagtcaaaagcatcgtccctaaagacgctcatatcatggcggttgtcaaggcgaacgct
tatggggcaggggccataaaagcgagcgaaatctttttacaagaaggggcacattatcta
ggggtagcgactttagatgaagctttagagttgcgctctcatttttctaaaacccccatt
ttgattttaggctatagccctaatgctaacgcttccatgctgattgataacgatttgagc
gctatgatttttagccttgaacaagcggaagttttttctcaaatggctttaaaatctcaa
aaacgcttaaaaatccatctcaaaattgataccggcatgcaccgcttgggattagagcct
aattttaaaagcatagaaaccattaaaaaaatctgcgctttaaaaggcttggaggtggag
gggatattcacgcatttaagcaacgctgacgctaagattaaaacccatgctaaaaaccaa
atgaaagcctttaacgcttttttagagcagcttttagatcaaaaaatagagtttcaatac
cgccatgcttacaattccgccggtatcctttctttgtgtaacgggaatgaaaatcgcttc
ttaaacctctatcgtccaggaatcatgctctatggtttttacccttctaatggaatgaaa
gaaacatgcccaaccattttaaaaaatgttatcagtttaaaagcccaaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcgagcatttttacaccaatgaagaa
actttagtgggtgttttagctctagggtatgcggacgggttaatgcgcgatttaggcaat
cgcattcaagtagcgatcaataaccaattagccccccttattggtaaggtgtgcatggat
cagtgctttgtcaaactcaataatattcaagccaaagagggcgatgaggtcatcttgttt
ggggataaaagcgctaaggctaacgacgcaagcgaaatcgctgcgcttttaaacaccatt
ccttatgaaaccatcagcaccctatccaaacgcttggagcgcgtctatatttaa

DBGET integrated database retrieval system