KEGG   Helicobacter pylori Puno120: HPPN120_05900Help
Entry
HPPN120_05900     CDS       T01919                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hep  Helicobacter pylori Puno120
Brite
KEGG Orthology (KO) [BR:hep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hep03012]
    HPPN120_05900
   03029 Mitochondrial biogenesis [BR:hep03029]
    HPPN120_05900
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hep04147]
    HPPN120_05900
Translation factors [BR:hep03012]
 Eukaryotic Type
  Elongation factors
   HPPN120_05900
 Prokaryotic Type
   HPPN120_05900
Mitochondrial biogenesis [BR:hep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HPPN120_05900
Exosome [BR:hep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HPPN120_05900
  Exosomal proteins of breast cancer cells
   HPPN120_05900
  Exosomal proteins of colorectal cancer cells
   HPPN120_05900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEN15772
UniProt: G2M6F1
LinkDB All DBs
Position
complement(1212129..1213328)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRATQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaacagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaagggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgattactggtgcagcgcaaatggac
ggagcgattttggttgtttctgcagctgatggccctatgcctcaaactagggagcatatc
ttgttatctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagagttggtagaaatggaagtgcgcgaattgttgagtgcg
tatgaatttcctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcaaaggctggcaatgtgggtgaatggggtgaaaaagtgcttaagctcatggctgaa
gtggatgcctatatccctactccagaaagggatactgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagagggactgtggttacaggtaggattgaaagaggt
gtggtgaaagtgggcgatgaagtggaaatcgttggtatcagagctacacaaaaaacgact
gtaaccggtgtggaaatgtttagaaaagagttagaaaaaggtgaggccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtagagcgcggtatggttctatgtaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctttccaaagaa
gaaggcgggagacacactccattcttcaccaactaccgcccgcaattctatgtgcgcacg
actgatgtgactggctctatcacccttcctgaaggcgtagaaatggttatgcctggcgat
aatgttaaaatcactgtggagttgattagccctgttgcgttagagttgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system