KEGG   Helicobacter pylori F32: HPF32_0203Help
Entry
HPF32_0203        CDS       T01911                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
heq  Helicobacter pylori F32
Pathway
heq00061  Fatty acid biosynthesis
heq00780  Biotin metabolism
heq01100  Metabolic pathways
heq01130  Biosynthesis of antibiotics
heq01212  Fatty acid metabolism
Module
heq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPF32_0203 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HPF32_0203 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HPF32_0203 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:heq01004]
    HPF32_0203 (fabI)
Enzymes [BR:heq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HPF32_0203 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HPF32_0203 (fabI)
Lipid biosynthesis proteins [BR:heq01004]
 Fatty acid synthase
  Component type
   HPF32_0203 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase DUF1509
Motif
Other DBs
NCBI-ProteinID: BAJ57785
UniProt: E6NN59
LinkDB All DBs
Structure
PDB: 

Position
206408..207235
Genome map
AA seq 275 aa AA seqDB search
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYV
YELDVSKEEHFKPLYDSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISV
YSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHN
IRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVS
GEVHFVDAGYHVMGMGAVEEKDNRATLLWDLHKEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttaaaaggtaaaaaagggcttattgtaggggtggcaaacaataaatccatc
gcttatgggatcgctcaatcttgtttcaatcaaggggctactttggctttcacttatttg
aatgagagcttagaaaagcgcgtgaggcctatcgcgcaggaattgaatagcccctatgtg
tatgaattagatgtgagcaaagaagagcatttcaagccgctatatgatagcgttaaaaag
gatttaggctcattggattttatcgttcatagcgtggcttttgcccctaaagaggcttta
gaggggagcttgttggaaacttctaaaagcgcgtttaacaccgctatggaaatttctgtt
tattctttaatagagctgacaaacaccctaaaacctttattgaataacggagcgtctgtt
ttgactttaagctatttaggcagcaccaaatacatggcgcattacaatgtgatgggattg
gctaaagcggctctagagagtgcggtgcgttatttagcggtggatttaggcaagcataac
ataagagtgaatgccctatcggccgggcctattaggacgctcgcttctagcgggatcgct
gattttagaatgattttaaaatggaatgaaatcaacgcccctttaagaaaaaatgtgagt
ttagaagaagtgggtaatgccgggatgtatttgctctctagcttgtctagtggggtgagt
ggggaagtgcattttgtggatgctggctatcatgttatgggcatgggggctgtggaagaa
aaagataatagagctacgctattgtgggatttgcataaagaacaataa

DBGET integrated database retrieval system