KEGG   Helicobacter pylori F32: HPF32_0704Help
Entry
HPF32_0704        CDS       T01911                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
heq  Helicobacter pylori F32
Pathway
heq00473  D-Alanine metabolism
heq00550  Peptidoglycan biosynthesis
heq01100  Metabolic pathways
heq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPF32_0704 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPF32_0704 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HPF32_0704 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:heq01011]
    HPF32_0704 (ddl)
Enzymes [BR:heq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPF32_0704 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:heq01011]
 Precursor biosynthesis
  Amino acid ligase
   HPF32_0704 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_TupA GARS_A RimK VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: BAJ58286
UniProt: E6NPL0
LinkDB All DBs
Position
770068..771111
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIALKETLKDRIKYFIFLDENHHFYLVEESNMHSKYFAQI
KEKKLPPLILTHNGLLKNSFLGTKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYSKYLTKLYAKDLGIKTLDCVLVNEKNRANALDLIGFNLPFIIKPSNAGSSLG
VSVVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYVEEPNKQEF
LDFKQKYLDFSRNKAPKANLSNTLEEQLKENFKKLYNDLFDGALIRCDFFVIENEVYLNE
INPIPGSLANYLFDDFKTTLENLAQSLPKTPKIPIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggaattttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagc
gcgatcgcgcttaaagaaacgctaaaggataggattaaatattttatttttttagatgaa
aaccatcatttttacttggttgaagaatccaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattaccccccctaatccttacgcataatggcttgcttaaaaactcgttt
ttaggcactaaaataatagaattacccttagtgattaatcttgtgcatgggggcgatggc
gaagacggaaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgctgagttatagcaaatatttaaccaagctttacgccaaagattta
ggaataaagactttagattgcgttcttgtgaatgaaaaaaaccgcgctaacgccctggat
ttgattggctttaatcttcctttcataatcaagcctagtaacgccgggagctctttaggg
gtgagcgttgtgaaagaagaaaaagaattgatttacgctttagacggtgcgtttgaatac
tctaaagaggtcttaatagagcctttcattcagggcgtgaaagaatacaatttagccggt
tgcaagatcaaaaaggatttttgtttttcctatgttgaagagcctaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaataaagcccctaaagcgaatctt
tctaacaccctagaagaacaattaaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgctcatccgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttggccaattatttgtttgatgattttaaaacaacgcta
gaaaatttagcgcaatcattacccaaaacccctaaaatcccaatcaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system