KEGG   Helicobacter pylori Rif1: C695_04840Help
Entry
C695_04840        CDS       T02317                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
her  Helicobacter pylori Rif1
Pathway
her02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:her00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C695_04840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:her02000]
    C695_04840
   02035 Bacterial motility proteins [BR:her02035]
    C695_04840
Transporters [BR:her02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    C695_04840
Bacterial motility proteins [BR:her02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    C695_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AFV43746
LinkDB All DBs
Position
complement(1000317..1001087)
Genome map
AA seq 256 aa AA seqDB search
MKKVLFLLVISFFGGFLNASSLYEKLINKETISVGTEGIYPPFTYHNKEGKLTGYDVEVA
RELAKELGVKIKFHETSWDIMLTGLKSGRFDMVANQVSLATKKRQAAFDKSLPYSYSGTI
MLVRKDENRIKDIKDIKGLRAANTLSSTYGEIAFKYDAQIVSVDSMAQALLLVAQKRADL
TLNSSLAILNYLNTHKDNPFKIAWESKEKDGGASFVINKHQEKALELINQAMQRLINKGV
LKRLGEQFFGKDVSQP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttttatttttgttggtaataagcttttttgggggttttttgaacgcttct
agcttgtatgaaaaactgattaataaagaaacgatcagcgttggcacagaaggcatttac
ccccctttcacttaccacaataaagaaggcaagctcaccggctatgatgtggaagtggct
agggagttggccaaagagcttggcgtgaagatcaaattccacgaaacttcatgggatatc
atgctgacaggtttgaaatcggggcgttttgatatggtcgctaaccaagtgagtttggcg
actaaaaaacgccaagcggcttttgataaaagcttgccttatagctattcaggcacgatc
atgctggtcaggaaagatgaaaaccgcattaaagatattaaagacatcaagggtttgaga
gcggctaacactttaagctccacttatggggaaatcgcttttaaatacgacgctcaaatc
gtttcggtggattctatggcgcaagctttgttgctggtggcgcaaaaacgagccgatttg
accttaaatagttctttagcgatcttaaactaccttaacacccacaaagataaccccttt
aaaatcgcatgggagtccaaagaaaaagatgggggcgcttcctttgttattaacaagcac
caagaaaaagccttagagcttatcaaccaagcgatgcaaagattgatcaacaaaggggtt
ttaaaacgcttaggcgaacaattttttggaaaagatgtcagccagccctaa

DBGET integrated database retrieval system