KEGG   Helicobacter pylori SouthAfrica7: HPSA_00460Help
Entry
HPSA_00460        CDS       T01921                                 

Definition
(GenBank) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00130  Ubiquinone and other terpenoid-quinone biosynthesis
hes00270  Cysteine and methionine metabolism
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hes00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HPSA_00460
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HPSA_00460
Enzymes [BR:hes01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     HPSA_00460
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     HPSA_00460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ADU84117
UniProt: E8QTU0
LinkDB All DBs
Position
complement(93276..93971)
Genome map
AA seq 231 aa AA seqDB search
MVQKIGILGAMREEITPILELFGVGFEEVSLGGNVFHKGVYNDKEIVVAYSKIGKVHSTL
TTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAQKLVQHDVDLSAFDHPLGFIPESAI
FIETSESLNALAKKIASEQHITLKEGIIASGDQFVHSKERKEFLTSEFKASAVEMEGASV
AFVCQKFGVPCCVLRSISDNADEKADISFDAFLEKSAQTSAKFLKSMVDGL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcaaaaaattggcattttaggggcgatgagagaagaaataacccctatcttggaa
ttgtttggcgtgggttttgaagaggtttctttaggagggaatgttttccataaaggcgtt
tataatgataaagaaatcgttgtcgcttatagcaaaattggcaaggtgcattccacttta
accacgacgagcatgattttagcgtttggcgttcaaaaggtgctttttagtggggtggct
gggagtttggttaaggatttaaaaatcaatgatttgttggtggctcaaaaattagtccag
catgatgtggatttgagtgcgtttgatcaccctttagggtttatcccagaaagcgcgatt
tttattgaaacgagcgaaagtttaaacgccctagctaaaaaaatcgctagcgagcaacat
atcacgctcaaagaaggcatcatcgcatcaggcgatcagtttgtccatagcaaggaaagg
aaagagtttttaactagcgagtttaaggcgagcgcggtggaaatggagggggcgagcgtg
gcgtttgtgtgccaaaaatttggcgtgccatgctgtgttttaaggagcattagcgataac
gccgatgaaaaagccgacattagctttgatgcatttttagaaaaaagcgctcaaacttca
gcgaaattcttaaaaagcatggtagatgggctttag

DBGET integrated database retrieval system