KEGG   Helicobacter sp. MIT 01-6242: BBW65_04760Help
Entry
BBW65_04760       CDS       T05984                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
het  Helicobacter sp. MIT 01-6242
Pathway
het00061  Fatty acid biosynthesis
het00780  Biotin metabolism
het01100  Metabolic pathways
het01212  Fatty acid metabolism
Module
het_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:het00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BBW65_04760
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BBW65_04760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:het01004]
    BBW65_04760
Enzymes [BR:het01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BBW65_04760
Lipid biosynthesis proteins [BR:het01004]
 Fatty acid synthase
  Component type
   BBW65_04760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ANV98152
UniProt: A0A1B1U626
LinkDB All DBs
Position
complement(1011679..1012131)
Genome map
AA seq 150 aa AA seqDB search
MFNVNTIKKILPHRYPMLLVDRVVNLEPNKKLEAYKNITINEEVFLGHFPKQPIYPGVMI
VEGMAQAGGILAFVSMFGDDYQKAEEKIVYFMTIDRVKFRTPVVPGDRLVYRVNVMKQKG
AVWQLDCQAYVEDKLVAEAELKAMVADAEV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatgtcaatactattaaaaaaatccttccacatcgctatccgatgttgcttgtc
gatcgcgtcgtaaatttggagccaaataagaagcttgaggcatacaaaaacatcacaatc
aacgaagaagtgtttttggggcatttccccaaacagcccatttatccgggcgtgatgatt
gtagaggggatggctcaagcagggggaattttggcatttgtgagtatgtttggcgatgat
tatcaaaaagcagaagaaaaaatcgtctattttatgacgatcgatcgtgtgaagtttaga
acccctgtggtgcccggagatcgtttggtctatcgtgtgaatgtgatgaagcaaaaaggt
gcagtgtggcaacttgattgccaagcctatgtcgaagacaaactagtcgcagaggcagag
ctcaaggcaatggttgcagatgcggaggtgtga

DBGET integrated database retrieval system