KEGG   Helicobacter pylori Puno135: HPPN135_00465Help
Entry
HPPN135_00465     CDS       T01920                                 

Definition
(GenBank) type II restriction enzyme R protein
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
heu  Helicobacter pylori Puno135
Brite
Enzymes [BR:heu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     HPPN135_00465
Prokaryotic defense system [BR:heu02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    HPPN135_00465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C Chordopox_A15
Motif
Other DBs
NCBI-ProteinID: AEN17806
UniProt: G2M791
LinkDB All DBs
Position
91447..92280
Genome map
AA seq 277 aa AA seqDB search
MKNHLPFDIFLQSLKISNRTLGFFTDWQKCLKSKNEISIALNHLNFLLGKGTQELKSCIK
SLFKEYPKAFNVLNILIAVRNKDEVVLDADGNFYPLHSYFENDEKVYQFICQTGLEQIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKVMENYLSGLFFQAQLNFKEQVDIREFEDLCQ
AFGDDIKKFDFVVYGRDKIYFIEANFYTISGSKLNEVARSYQDLSLKFEAFPNYEFIWIT
DGIGWWDAKSKLQEAYKSVEIYNLSNVGDFISKVQKW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccatttgccttttgatatttttttgcaaagtcttaagataagtaataggact
ttaggctttttcaccgattggcaaaagtgtctcaaaagtaaaaatgaaataagcatcgct
ttaaatcatttgaattttttattggggaaaggcacacaagaacttaaaagttgcattaaa
agtctttttaaagaataccccaaagcttttaatgttttaaatattctcattgctgtgagg
aataaagatgaggtagtgcttgatgctgatggcaatttttaccccctacattcttatttt
gaaaatgatgaaaaggtctatcaattcatctgtcaaacggggttggagcaaattttttgt
aacagaaatattaaagatttaaatgattttgtttttggtatagaagtggggcttgatagc
aatgcaagaaaaaatcgcagcggaaaagttatggaaaattatcttagcggtctttttttt
caagctcaattaaattttaaagaacaagtagatattagagaatttgaggatttatgccaa
gcttttggagatgatattaaaaaatttgattttgttgtttatggtagagataaaatttat
tttatagaagctaatttttatactattagtgggagtaagcttaatgaagtcgcaagatcc
tatcaagacttatctttaaaatttgaagcattccccaattacgaatttatttggataacc
gatggcataggttggtgggacgctaaaagcaagctccaagaagcttacaaatctgtagaa
atctacaatttgagcaatgtgggtgattttatatcaaaggtgcaaaaatggtaa

DBGET integrated database retrieval system