KEGG   Helicobacter pylori Puno135: HPPN135_05540Help
Entry
HPPN135_05540     CDS       T01920                                 

Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00061  Fatty acid biosynthesis
heu00620  Pyruvate metabolism
heu00640  Propanoate metabolism
heu01100  Metabolic pathways
heu01110  Biosynthesis of secondary metabolites
heu01120  Microbial metabolism in diverse environments
heu01130  Biosynthesis of antibiotics
heu01200  Carbon metabolism
heu01212  Fatty acid metabolism
Module
heu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:heu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPPN135_05540
   00640 Propanoate metabolism
    HPPN135_05540
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPPN135_05540
Enzymes [BR:heu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     HPPN135_05540
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HPPN135_05540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_C Biotin_carb_N Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATPgrasp_ST ATPgrasp_Ter ATP-grasp_5 LAL_C2
Motif
Other DBs
NCBI-ProteinID: AEN18774
UniProt: G2M8W1
LinkDB All DBs
Position
1133884..1135254
Genome map
AA seq 456 aa AA seqDB search
MNNKENKKVEKKELSRILIANRGEIALRAIQTIQEMGKESIAIYSIADKDAHYLNTANAK
VCIGGAKSSESYLNIPAIISAAELFEADAIFPGYGFLSENQNFVEICSHHSLEFIGPSAK
VMALMSDKSKAKSVMKEAGMPVIEGSDGLLKSYQEAEEIADKIGYPVIIKAAAGGGGRGM
RVVEDKSRLKNLYLAAETEALSAFGDGSVYLEKFINKPKHIEVQILADKHGNVIHVGERD
CSVQRRQQKLIEETPAVVLEEGVRKRLLETAIKAAKYIGYVGAGTFEFLLDSNMKDFYFM
EMNTRLQVEHTISEMVSGLNLIEWMIKIAQGEELPKQESFSLKGHAIECRITAEDPKKFY
PSPGKITEWIAPGGVNVRLDSHAHAHYVVPTHYDSMIGKLVVWGENRERAIAKMKRALKE
FKVEGIKTTIPFHLEMLENADFRQAKIHTKYLEENF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaagaaaataaaaaggtagaaaaaaaagagctttcgcgcattttgatcgct
aatagaggcgagatcgctttaagagcgatccaaaccattcaagaaatgggtaaagaatcc
atagccatttattctatcgctgacaaggacgcccactatctcaatacagctaacgcaaaa
gtgtgtatagggggggcaaaatccagcgagagttacttgaatatccctgcaatcattagc
gcggcggaattgtttgaagcggatgcgattttccctgggtatgggtttttgagcgagaat
cagaattttgtagagatttgctcgcaccattctttagagtttattggcccgagcgcgaaa
gtcatggctttaatgagcgacaaatccaaagccaaaagcgtgatgaaagaagccggcatg
cctgtgattgagggcagtgatgggttgcttaaaagctatcaagaagctgaagaaatcgct
gataaaatcggctaccctgtcatcatcaaagcggccgctggtgggggcgggagaggcatg
cgtgtcgtagaagataaatccaggctcaaaaacctttatctagccgcagaaacggaagct
ttgagcgcgtttggcgatgggagcgtgtatttagaaaaattcatcaacaagcctaaacac
attgaagtccaaattctagccgataagcatggcaatgtcattcatgtgggcgaaagggat
tgttcggtgcaaagacgccagcaaaagctcattgaagaaaccccggcagtggttttagaa
gagggcgttcgtaagcgtttgctagaaacagcgattaaagccgctaaatacatcggctat
gtgggggctgggacttttgaatttttgctcgattctaacatgaaagatttttatttcatg
gagatgaacactcgtttgcaagtggaacacaccattagcgaaatggtgagcgggttaaac
ctcattgaatggatgattaaaatcgctcaaggcgaggaattgcccaagcaagaaagcttc
tctctcaaagggcatgcgatagaatgccgaatcactgcagaagatcctaaaaaattctac
ccaagcccgggtaaaatcaccgaatggatcgcccctggtggggtgaatgtgcgccttgat
tcgcacgcacatgctcattatgtcgtgcctacgcactatgattctatgattggcaagctc
gttgtgtggggggaaaacagagaaagagcgatcgctaagatgaaaagggctttaaaggaa
tttaaggtagaaggcattaaaacgaccattcctttccaccttgaaatgcttgaaaatgcg
gatttcaggcaagcaaaaatccacacgaagtatttggaagaaaatttttaa

DBGET integrated database retrieval system