KEGG   Helicobacter pylori F57: HPF57_0028Help
Entry
HPF57_0028        CDS       T01912                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hex  Helicobacter pylori F57
Pathway
hex00061  Fatty acid biosynthesis
hex00780  Biotin metabolism
hex01100  Metabolic pathways
hex01212  Fatty acid metabolism
Module
hex_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPF57_0028 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HPF57_0028 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hex01004]
    HPF57_0028 (fabZ)
Enzymes [BR:hex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HPF57_0028 (fabZ)
Lipid biosynthesis proteins [BR:hex01004]
 Fatty acid synthase
  Component type
   HPF57_0028 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: BAJ59102
UniProt: E6NPN6
LinkDB All DBs
Structure
PDB: 

Position
31209..31688
Genome map
AA seq 159 aa AA seqDB search
MEQNHQNLQSQFFIEHILQILPHRYPMLLVDRITELQANKKIVAYKNITFNEDVFNGHFP
NKPIFPGVLIVEGMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE
YHLEVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAERD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaatcatcaaaacttgcaatctcaattttttatagagcatatcttacagatt
ttacctcaccgctatcccatgctcttagtggatagaattacagagttacaagccaataaa
aaaattgtcgcttataagaatatcacttttaatgaagatgtgtttaacgggcatttccct
aataagcccattttcccgggtgttttgatcgtagagggcatggcgcaaagcggagggttt
ttagccttcactagtttgtgggggtttgaccctgaaatagccaaaaccaaaatcgtatat
ttcatgacgattgacaaggttaaattccgcattcctgtaaccccaggcgacagattagaa
taccatttagaagtcttaaagcataagggcatgatctggcaagtgggcggcacggctcaa
gtggatggcaaagtggtcgctgaagccgaattaaaagccatgatcgcagagagagattaa

DBGET integrated database retrieval system