KEGG   Helicobacter pylori XZ274: MWE_0183Help
Entry
MWE_0183          CDS       T02130                                 

Definition
(GenBank) type II restriction enzyme R protein (HsdR)
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
hey  Helicobacter pylori XZ274
Brite
KEGG Orthology (KO) [BR:hey00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:hey02048]
    MWE_0183
Enzymes [BR:hey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     MWE_0183
Prokaryotic defense system [BR:hey02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    MWE_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C Alliinase_C
Motif
Other DBs
NCBI-ProteinID: AFJ81143
UniProt: I2DEH7
LinkDB All DBs
Position
complement(159236..160069)
Genome map
AA seq 277 aa AA seqDB search
MKNHLPFDIFLQSLKISNRNLGFFTDWQKCLKNKNEISIALNHLNFLLGKGVQELKSCVK
SLFKEYPKAFNVLNILIAVRNKDEVVLDADGNFYPLHSYFENDEKVYQFICQTGLEQIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKAMENHLSSLFFQAQLNFKEQVDIREFEDLYQ
AFGDDIKKFDFVVYGKDTTYFIEANFYTISGSKLNEVARSYQELALKFEAFPNYEFIWIT
DGIGWLDAKSKLQEAYKSVEIYNLSNVNDFISKAQKW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccatctaccttttgatatttttttgcagagtcttaagataagcaataggaat
ttaggctttttcaccgattggcaaaagtgcctcaaaaataaaaatgaaataagcatcgct
ttaaatcatttaaattttttgttggggaaaggcgtgcaagaacttaaaagttgcgttaag
agtctttttaaagaataccccaaagcttttaatgttttaaatattctcattgctgtgaga
aataaagatgaggtagtgcttgatgctgatggcaatttttaccccctacattcttatttt
gaaaatgatgaaaaggtttatcaattcatctgtcaaacggggttggagcaaattttttgt
aacagaaatattaaagatttaaatgattttgtttttggtatagaagtggggcttgatagc
aatgcaagaaaaaatcgtagcggaaaggctatggaaaatcatcttagcagtctttttttt
caagctcaattaaattttaaagaacaagtagatattagagaatttgaggatttataccaa
gcttttggagatgatattaaaaaatttgattttgttgtttatggtaaagatacaacttat
tttatagaagctaatttttataccattagtgggagtaagcttaatgaagtcgcaagatcc
tatcaagaattagctttaaaatttgaagcattccccaattacgaatttatttggataacc
gatggcataggttggctggacgctaaaagcaaacttcaagaagcttacaaatctgtggag
atctacaatttgagcaatgtgaatgattttatatcaaaggcacaaaaatggtaa

DBGET integrated database retrieval system